Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9U343

Protein Details
Accession A0A1L9U343   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-120GSVTPSPRKKRPAKKVQDEEGSDDEPATPTPKKKRVTKKKVKDEEVSDEVHydrophilic
NLS Segment(s)
PositionSequence
77-85PRKKRPAKK
101-111PKKKRVTKKKV
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MRWTPQNEELLWQTIFETQTLNLDLDKIAEGWPGDDKPTAKALKEHLGKYRKGIKSGITFSMNTKRPGDDGSVTPSPRKKRPAKKVQDEEGSDDEPATPTPKKKRVTKKKVKDEEVSDEVGVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.16
4 0.15
5 0.11
6 0.14
7 0.15
8 0.15
9 0.11
10 0.11
11 0.11
12 0.11
13 0.11
14 0.09
15 0.07
16 0.08
17 0.08
18 0.08
19 0.11
20 0.11
21 0.12
22 0.14
23 0.14
24 0.15
25 0.21
26 0.21
27 0.2
28 0.22
29 0.24
30 0.3
31 0.35
32 0.35
33 0.37
34 0.42
35 0.41
36 0.44
37 0.5
38 0.44
39 0.41
40 0.4
41 0.36
42 0.37
43 0.39
44 0.37
45 0.29
46 0.27
47 0.27
48 0.34
49 0.32
50 0.29
51 0.27
52 0.24
53 0.22
54 0.23
55 0.23
56 0.17
57 0.15
58 0.19
59 0.22
60 0.22
61 0.25
62 0.29
63 0.32
64 0.36
65 0.44
66 0.48
67 0.55
68 0.66
69 0.74
70 0.79
71 0.85
72 0.88
73 0.86
74 0.84
75 0.75
76 0.69
77 0.61
78 0.51
79 0.4
80 0.32
81 0.24
82 0.17
83 0.16
84 0.15
85 0.15
86 0.21
87 0.31
88 0.39
89 0.46
90 0.56
91 0.67
92 0.74
93 0.82
94 0.86
95 0.88
96 0.91
97 0.94
98 0.92
99 0.88
100 0.84
101 0.81
102 0.74
103 0.65
104 0.54