Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9ULS7

Protein Details
Accession A0A1L9ULS7    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-74EQNNVPTRGMRRNKRRKKRIYQTQGQSLDHydrophilic
NLS Segment(s)
PositionSequence
39-43PSKRR
51-64PTRGMRRNKRRKKR
81-133RGGKREGGRRRERERGEGNWESKESSQAGQPSKRQREGAGKESKIPGIKTRPP
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAKSPEDKVQGESRRVVTWQSESAECRRLGRGTKQDTKPSKRRSTEQNNVPTRGMRRNKRRKKRIYQTQGQSLDNGEGGLRGGKREGGRRRERERGEGNWESKESSQAGQPSKRQREGAGKESKIPGIKTRPPKQGENCNSSLRWLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.38
4 0.32
5 0.3
6 0.3
7 0.28
8 0.28
9 0.3
10 0.33
11 0.36
12 0.33
13 0.31
14 0.3
15 0.31
16 0.33
17 0.39
18 0.45
19 0.48
20 0.57
21 0.61
22 0.67
23 0.73
24 0.77
25 0.78
26 0.78
27 0.79
28 0.75
29 0.75
30 0.75
31 0.76
32 0.77
33 0.76
34 0.76
35 0.71
36 0.69
37 0.64
38 0.56
39 0.49
40 0.49
41 0.49
42 0.49
43 0.55
44 0.63
45 0.73
46 0.81
47 0.88
48 0.89
49 0.92
50 0.93
51 0.93
52 0.91
53 0.9
54 0.85
55 0.84
56 0.76
57 0.65
58 0.55
59 0.44
60 0.34
61 0.25
62 0.18
63 0.09
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.09
71 0.12
72 0.2
73 0.28
74 0.36
75 0.46
76 0.54
77 0.6
78 0.66
79 0.67
80 0.66
81 0.64
82 0.59
83 0.57
84 0.55
85 0.51
86 0.45
87 0.42
88 0.36
89 0.31
90 0.29
91 0.22
92 0.17
93 0.18
94 0.21
95 0.26
96 0.3
97 0.36
98 0.44
99 0.51
100 0.54
101 0.52
102 0.52
103 0.57
104 0.58
105 0.61
106 0.6
107 0.54
108 0.54
109 0.55
110 0.54
111 0.47
112 0.42
113 0.4
114 0.4
115 0.47
116 0.53
117 0.59
118 0.65
119 0.66
120 0.74
121 0.75
122 0.77
123 0.77
124 0.75
125 0.7
126 0.66
127 0.61