Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9U4J4

Protein Details
Accession A0A1L9U4J4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-107AGSKVEKPSRQQRKQRKNRSKKFRGTAKTKGPKKNKDBasic
NLS Segment(s)
PositionSequence
73-107SKVEKPSRQQRKQRKNRSKKFRGTAKTKGPKKNKD
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences DVLHPNRANVSKDELRDKLADLYKSNKDQVSVFGFRTQYGGGKSTGFALIYDSQEALKKFEPLYRLVRIGAGSKVEKPSRQQRKQRKNRSKKFRGTAKTKGPKKNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.38
4 0.37
5 0.36
6 0.36
7 0.34
8 0.3
9 0.35
10 0.38
11 0.4
12 0.42
13 0.35
14 0.31
15 0.29
16 0.31
17 0.32
18 0.28
19 0.25
20 0.26
21 0.25
22 0.24
23 0.25
24 0.21
25 0.16
26 0.15
27 0.16
28 0.12
29 0.13
30 0.13
31 0.12
32 0.12
33 0.1
34 0.08
35 0.09
36 0.1
37 0.1
38 0.1
39 0.09
40 0.09
41 0.12
42 0.12
43 0.12
44 0.11
45 0.12
46 0.12
47 0.15
48 0.16
49 0.18
50 0.22
51 0.22
52 0.23
53 0.21
54 0.22
55 0.2
56 0.21
57 0.18
58 0.16
59 0.15
60 0.17
61 0.23
62 0.24
63 0.26
64 0.31
65 0.4
66 0.48
67 0.57
68 0.65
69 0.7
70 0.79
71 0.88
72 0.93
73 0.94
74 0.94
75 0.95
76 0.96
77 0.95
78 0.94
79 0.93
80 0.92
81 0.91
82 0.88
83 0.87
84 0.87
85 0.87
86 0.85
87 0.86