Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VF70

Protein Details
Accession G0VF70    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
147-172LTTPSPRIVKIKSKKKKLGLKVNLKPHydrophilic
NLS Segment(s)
PositionSequence
121-172KKKRLLELKSKKKPSASVHDSDKSPKLTTPSPRIVKIKSKKKKLGLKVNLKP
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019331  FAM192A/Fyv6_N  
Gene Ontology GO:0005634  C:nucleus  
KEGG ncs:NCAS_0E00650  -  
Pfam View protein in Pfam  
PF10187  FAM192A_Fyv6_N  
Amino Acid Sequences MNTSRNKQQQNRSQGSPNKQPLTFVSEGVTNIEDENEKAKLEQEKFERESKIRSRKTLRDQLRSSAISKQKEFNGLVKQRESFNRLNEEEIEFFKSIEDAKLAEESKMNEYLSSKLNTFEKKKRLLELKSKKKPSASVHDSDKSPKLTTPSPRIVKIKSKKKKLGLKVNLKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.75
4 0.74
5 0.69
6 0.63
7 0.59
8 0.52
9 0.52
10 0.44
11 0.35
12 0.27
13 0.23
14 0.23
15 0.22
16 0.2
17 0.12
18 0.11
19 0.12
20 0.11
21 0.1
22 0.12
23 0.11
24 0.11
25 0.1
26 0.14
27 0.21
28 0.22
29 0.28
30 0.31
31 0.37
32 0.41
33 0.45
34 0.46
35 0.4
36 0.46
37 0.49
38 0.55
39 0.52
40 0.57
41 0.6
42 0.65
43 0.73
44 0.75
45 0.73
46 0.72
47 0.7
48 0.66
49 0.64
50 0.57
51 0.49
52 0.46
53 0.44
54 0.39
55 0.38
56 0.37
57 0.33
58 0.36
59 0.35
60 0.32
61 0.35
62 0.35
63 0.36
64 0.35
65 0.34
66 0.33
67 0.34
68 0.36
69 0.29
70 0.28
71 0.31
72 0.29
73 0.3
74 0.28
75 0.27
76 0.22
77 0.2
78 0.19
79 0.13
80 0.13
81 0.11
82 0.11
83 0.09
84 0.09
85 0.08
86 0.06
87 0.06
88 0.09
89 0.1
90 0.1
91 0.11
92 0.12
93 0.14
94 0.16
95 0.15
96 0.13
97 0.14
98 0.15
99 0.17
100 0.17
101 0.15
102 0.16
103 0.2
104 0.26
105 0.32
106 0.38
107 0.42
108 0.49
109 0.51
110 0.56
111 0.6
112 0.61
113 0.66
114 0.69
115 0.73
116 0.75
117 0.79
118 0.76
119 0.71
120 0.71
121 0.68
122 0.67
123 0.63
124 0.59
125 0.6
126 0.61
127 0.59
128 0.56
129 0.53
130 0.45
131 0.4
132 0.36
133 0.34
134 0.36
135 0.43
136 0.46
137 0.52
138 0.54
139 0.59
140 0.62
141 0.63
142 0.67
143 0.68
144 0.71
145 0.72
146 0.77
147 0.8
148 0.85
149 0.89
150 0.89
151 0.89
152 0.89