Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9UUZ4

Protein Details
Accession A0A1L9UUZ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
205-228IWTPGLAVRRRNRKLPERRSSLFGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034751  Yippee  
IPR004910  Yippee/Mis18/Cereblon  
IPR039058  Yippee_fam  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF03226  Yippee-Mis18  
PROSITE View protein in PROSITE  
PS51792  YIPPEE  
Amino Acid Sequences MFPKFLLRPSFFGDKQQRVRPRVTTSEAGPGPSPNPNDASYLEGHVSCIRCSCCAADVCLTSQIISKGFTGRYGRAYLVSGEPALARKPSPTDTLLNTMMQKPVPRRLVTGAHTVGDINCSICGNVLGWKYIAAEEESQRYKVGKFILETERVILSSCWESPAFVESALLPAYSGFTEAGHGQPSNSIEFDSQNEDECEDLFSGIWTPGLAVRRRNRKLPERRSSLFGITAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.67
4 0.7
5 0.67
6 0.72
7 0.68
8 0.66
9 0.64
10 0.62
11 0.56
12 0.49
13 0.53
14 0.48
15 0.43
16 0.37
17 0.31
18 0.27
19 0.29
20 0.29
21 0.22
22 0.24
23 0.23
24 0.25
25 0.24
26 0.25
27 0.21
28 0.21
29 0.2
30 0.17
31 0.17
32 0.18
33 0.19
34 0.16
35 0.19
36 0.18
37 0.17
38 0.19
39 0.18
40 0.19
41 0.19
42 0.21
43 0.2
44 0.2
45 0.21
46 0.21
47 0.2
48 0.16
49 0.17
50 0.16
51 0.14
52 0.14
53 0.13
54 0.14
55 0.14
56 0.18
57 0.19
58 0.2
59 0.22
60 0.22
61 0.22
62 0.2
63 0.21
64 0.18
65 0.16
66 0.15
67 0.12
68 0.1
69 0.1
70 0.1
71 0.1
72 0.09
73 0.08
74 0.09
75 0.11
76 0.13
77 0.16
78 0.18
79 0.19
80 0.21
81 0.25
82 0.25
83 0.24
84 0.23
85 0.21
86 0.19
87 0.18
88 0.19
89 0.17
90 0.23
91 0.26
92 0.25
93 0.26
94 0.28
95 0.32
96 0.31
97 0.34
98 0.27
99 0.23
100 0.22
101 0.21
102 0.17
103 0.13
104 0.11
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.08
113 0.08
114 0.08
115 0.08
116 0.09
117 0.09
118 0.09
119 0.1
120 0.07
121 0.09
122 0.09
123 0.14
124 0.15
125 0.15
126 0.16
127 0.16
128 0.15
129 0.16
130 0.17
131 0.15
132 0.15
133 0.2
134 0.24
135 0.25
136 0.25
137 0.24
138 0.22
139 0.2
140 0.19
141 0.14
142 0.11
143 0.11
144 0.11
145 0.12
146 0.11
147 0.11
148 0.11
149 0.13
150 0.11
151 0.09
152 0.09
153 0.07
154 0.09
155 0.09
156 0.08
157 0.06
158 0.05
159 0.06
160 0.06
161 0.07
162 0.06
163 0.05
164 0.07
165 0.08
166 0.09
167 0.11
168 0.11
169 0.1
170 0.13
171 0.14
172 0.15
173 0.14
174 0.14
175 0.13
176 0.14
177 0.16
178 0.19
179 0.18
180 0.18
181 0.19
182 0.18
183 0.18
184 0.16
185 0.16
186 0.11
187 0.1
188 0.08
189 0.08
190 0.09
191 0.09
192 0.09
193 0.07
194 0.07
195 0.1
196 0.17
197 0.2
198 0.28
199 0.37
200 0.48
201 0.54
202 0.62
203 0.68
204 0.72
205 0.8
206 0.82
207 0.84
208 0.82
209 0.8
210 0.77
211 0.72
212 0.65