Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0V715

Protein Details
Accession G0V715    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-52AYPPYPFKRLSKEHPKKHDTNLKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021036  Ribosomal_S35_mit  
KEGG ncs:NCAS_0A07050  -  
Pfam View protein in Pfam  
PF12298  Bot1p  
Amino Acid Sequences MLLQPANSTTVAHFLIYQQVRNISRRRIAYPPYPFKRLSKEHPKKHDTNLKAAMRQFLGPKNYKGEYVMNKYTRVPTNHIPNYIKPNRERGQALVNPVTGKPMVIRPDGKLVEVAESSERDSYGSVSAKGANMLQPFPSNPHCKTNYIISNELKEEIYELIQVQGQSTQQVSQKYGLKIPRIEAIVKLMTIEKKWESHNRISPSLDTFAKTMYGMFPIFEPELTFQRENLSEIPVPEKTLSSRFITIAESEPFGPVDAAEVLELEPAVKTLEKLATVGEHSQGHHANGSEKHKKKVVYGAVKEGDRSIFKFTDARVGQVGFRYGSGNRDSKKDRKIGFDSLGKMIYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.23
3 0.24
4 0.25
5 0.24
6 0.31
7 0.35
8 0.41
9 0.47
10 0.46
11 0.51
12 0.53
13 0.55
14 0.56
15 0.58
16 0.61
17 0.65
18 0.68
19 0.67
20 0.68
21 0.66
22 0.64
23 0.66
24 0.64
25 0.64
26 0.65
27 0.69
28 0.74
29 0.81
30 0.85
31 0.81
32 0.84
33 0.83
34 0.76
35 0.75
36 0.74
37 0.69
38 0.66
39 0.62
40 0.56
41 0.48
42 0.46
43 0.42
44 0.38
45 0.41
46 0.4
47 0.41
48 0.43
49 0.42
50 0.4
51 0.38
52 0.39
53 0.39
54 0.42
55 0.48
56 0.44
57 0.45
58 0.46
59 0.5
60 0.49
61 0.45
62 0.43
63 0.42
64 0.5
65 0.53
66 0.57
67 0.54
68 0.52
69 0.59
70 0.59
71 0.58
72 0.5
73 0.56
74 0.52
75 0.54
76 0.52
77 0.44
78 0.47
79 0.43
80 0.46
81 0.39
82 0.36
83 0.32
84 0.3
85 0.29
86 0.2
87 0.17
88 0.13
89 0.15
90 0.17
91 0.2
92 0.22
93 0.21
94 0.29
95 0.29
96 0.28
97 0.25
98 0.22
99 0.2
100 0.18
101 0.17
102 0.11
103 0.11
104 0.12
105 0.11
106 0.11
107 0.09
108 0.09
109 0.09
110 0.11
111 0.12
112 0.11
113 0.12
114 0.13
115 0.13
116 0.13
117 0.13
118 0.12
119 0.12
120 0.12
121 0.12
122 0.12
123 0.12
124 0.15
125 0.2
126 0.23
127 0.24
128 0.3
129 0.32
130 0.33
131 0.34
132 0.38
133 0.38
134 0.37
135 0.4
136 0.34
137 0.34
138 0.32
139 0.32
140 0.24
141 0.18
142 0.15
143 0.1
144 0.09
145 0.07
146 0.07
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.1
156 0.11
157 0.13
158 0.14
159 0.17
160 0.22
161 0.22
162 0.26
163 0.27
164 0.27
165 0.27
166 0.27
167 0.27
168 0.23
169 0.23
170 0.18
171 0.18
172 0.15
173 0.14
174 0.13
175 0.12
176 0.11
177 0.11
178 0.13
179 0.12
180 0.13
181 0.18
182 0.26
183 0.29
184 0.35
185 0.42
186 0.44
187 0.45
188 0.45
189 0.42
190 0.36
191 0.34
192 0.28
193 0.22
194 0.17
195 0.15
196 0.14
197 0.13
198 0.11
199 0.08
200 0.09
201 0.08
202 0.08
203 0.08
204 0.09
205 0.1
206 0.09
207 0.09
208 0.09
209 0.13
210 0.17
211 0.17
212 0.15
213 0.18
214 0.18
215 0.19
216 0.18
217 0.19
218 0.16
219 0.16
220 0.19
221 0.17
222 0.18
223 0.16
224 0.16
225 0.14
226 0.16
227 0.19
228 0.18
229 0.2
230 0.19
231 0.19
232 0.19
233 0.19
234 0.19
235 0.17
236 0.16
237 0.15
238 0.15
239 0.14
240 0.13
241 0.11
242 0.07
243 0.08
244 0.07
245 0.07
246 0.06
247 0.06
248 0.06
249 0.06
250 0.06
251 0.05
252 0.04
253 0.04
254 0.05
255 0.05
256 0.06
257 0.08
258 0.1
259 0.11
260 0.11
261 0.11
262 0.12
263 0.14
264 0.15
265 0.16
266 0.15
267 0.16
268 0.2
269 0.22
270 0.21
271 0.21
272 0.21
273 0.22
274 0.27
275 0.36
276 0.41
277 0.44
278 0.49
279 0.52
280 0.52
281 0.51
282 0.55
283 0.56
284 0.56
285 0.56
286 0.59
287 0.6
288 0.58
289 0.55
290 0.47
291 0.41
292 0.33
293 0.3
294 0.27
295 0.22
296 0.23
297 0.26
298 0.25
299 0.31
300 0.29
301 0.3
302 0.27
303 0.28
304 0.28
305 0.27
306 0.29
307 0.19
308 0.2
309 0.2
310 0.18
311 0.22
312 0.26
313 0.31
314 0.31
315 0.38
316 0.46
317 0.51
318 0.59
319 0.63
320 0.62
321 0.64
322 0.68
323 0.67
324 0.67
325 0.65
326 0.6
327 0.55