Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VJW2

Protein Details
Accession G0VJW2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAPSTKEPKKRTVRRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
6-24KEPKKRTVRRKKDPNAPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ncs:NCAS_0I01260  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAPSTKEPKKRTVRRKKDPNAPKRALSSYMFFANATRDIVRSENPDVTFGQVGKLLGERWKALTPEEKEPFELKAKQDKERYASEKALYDATLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.94
3 0.94
4 0.93
5 0.93
6 0.93
7 0.92
8 0.85
9 0.78
10 0.72
11 0.65
12 0.58
13 0.5
14 0.42
15 0.34
16 0.3
17 0.27
18 0.21
19 0.19
20 0.17
21 0.15
22 0.14
23 0.12
24 0.11
25 0.11
26 0.13
27 0.14
28 0.15
29 0.16
30 0.18
31 0.18
32 0.19
33 0.17
34 0.17
35 0.17
36 0.13
37 0.11
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.1
44 0.11
45 0.11
46 0.13
47 0.15
48 0.16
49 0.17
50 0.24
51 0.25
52 0.33
53 0.37
54 0.36
55 0.36
56 0.36
57 0.37
58 0.35
59 0.35
60 0.31
61 0.36
62 0.4
63 0.45
64 0.51
65 0.53
66 0.52
67 0.57
68 0.58
69 0.54
70 0.54
71 0.49
72 0.45
73 0.41
74 0.38