Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UKY9

Protein Details
Accession A0A1L9UKY9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-105KNPSTECKRQKDYAKCHPDRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 5, E.R. 4, golg 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQEIFDSVANKQTLRRIKLEFYPMCLILVTFWMVCSVLLLSTAWWWWWWWSVSSVSYYYQDGSCMLDWSTVLCVPFLSRVHLQIFKNPSTECKRQKDYAKCHPDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.39
4 0.43
5 0.48
6 0.56
7 0.48
8 0.45
9 0.45
10 0.4
11 0.36
12 0.31
13 0.25
14 0.15
15 0.15
16 0.11
17 0.07
18 0.06
19 0.06
20 0.07
21 0.06
22 0.06
23 0.05
24 0.04
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.08
35 0.08
36 0.09
37 0.1
38 0.11
39 0.12
40 0.13
41 0.13
42 0.12
43 0.13
44 0.13
45 0.12
46 0.11
47 0.1
48 0.09
49 0.1
50 0.09
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.12
63 0.12
64 0.15
65 0.15
66 0.18
67 0.22
68 0.28
69 0.28
70 0.32
71 0.37
72 0.34
73 0.36
74 0.34
75 0.38
76 0.4
77 0.49
78 0.52
79 0.55
80 0.6
81 0.65
82 0.75
83 0.77
84 0.78
85 0.8