Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9U4U6

Protein Details
Accession A0A1L9U4U6    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
335-354LPNIKVFSKRQTRLHRDDEMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018305  Ribosomal_L50_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF10501  Ribosomal_L50  
Amino Acid Sequences MRPSVRLLSLDVQGASRTLYVCSVCRNEARPRPIVARQFLRHASNTPDSLSERVRRKLWGTDNPPGLKDPYGESLLEKRFGKAKAQPEAEAELEPGVDYEPATTWEGLERVGHLGGWKDVPRAEVDRVGTFGLKKKLRRQGPLSLAAHQAAVEICLMHALNKPLTSVCNVAEHDKAVFKMIWKTKIVPGEAGNWGSALEYHNKQAKEALVYIFEQIGGSQPEAVEQQEAAEETAEVEEFEEAAWEGEEEETSKVPFFGYQDARDKGFLALSLEDPETKFAFLKRFSQLSGHFFPDNIVHQISSVKQAVDYVQGQLNPKPKKLAEILEKNDRLQSLPNIKVFSKRQTRLHRDDEMGRRKIIEAELRSRGLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.14
4 0.12
5 0.11
6 0.13
7 0.14
8 0.16
9 0.22
10 0.25
11 0.28
12 0.32
13 0.37
14 0.44
15 0.51
16 0.56
17 0.54
18 0.55
19 0.58
20 0.61
21 0.64
22 0.61
23 0.61
24 0.58
25 0.61
26 0.61
27 0.59
28 0.53
29 0.48
30 0.47
31 0.43
32 0.41
33 0.35
34 0.34
35 0.31
36 0.33
37 0.36
38 0.36
39 0.38
40 0.42
41 0.43
42 0.44
43 0.46
44 0.51
45 0.54
46 0.56
47 0.57
48 0.6
49 0.65
50 0.63
51 0.6
52 0.53
53 0.47
54 0.37
55 0.31
56 0.26
57 0.22
58 0.22
59 0.21
60 0.21
61 0.26
62 0.27
63 0.31
64 0.29
65 0.26
66 0.3
67 0.32
68 0.35
69 0.35
70 0.41
71 0.44
72 0.47
73 0.46
74 0.43
75 0.45
76 0.4
77 0.33
78 0.25
79 0.17
80 0.14
81 0.12
82 0.09
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.08
89 0.1
90 0.09
91 0.09
92 0.1
93 0.11
94 0.11
95 0.1
96 0.09
97 0.09
98 0.09
99 0.09
100 0.08
101 0.09
102 0.1
103 0.12
104 0.12
105 0.12
106 0.13
107 0.14
108 0.15
109 0.18
110 0.18
111 0.19
112 0.2
113 0.19
114 0.19
115 0.19
116 0.17
117 0.16
118 0.2
119 0.24
120 0.27
121 0.32
122 0.4
123 0.48
124 0.54
125 0.6
126 0.6
127 0.61
128 0.63
129 0.67
130 0.59
131 0.53
132 0.47
133 0.4
134 0.34
135 0.25
136 0.19
137 0.1
138 0.09
139 0.06
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.08
146 0.09
147 0.1
148 0.1
149 0.11
150 0.1
151 0.11
152 0.12
153 0.11
154 0.1
155 0.13
156 0.13
157 0.15
158 0.15
159 0.15
160 0.14
161 0.13
162 0.13
163 0.11
164 0.1
165 0.1
166 0.16
167 0.2
168 0.23
169 0.23
170 0.25
171 0.27
172 0.3
173 0.29
174 0.24
175 0.21
176 0.21
177 0.21
178 0.2
179 0.16
180 0.12
181 0.11
182 0.1
183 0.09
184 0.07
185 0.09
186 0.1
187 0.14
188 0.19
189 0.19
190 0.19
191 0.21
192 0.21
193 0.19
194 0.19
195 0.16
196 0.13
197 0.14
198 0.14
199 0.12
200 0.11
201 0.08
202 0.07
203 0.08
204 0.07
205 0.07
206 0.06
207 0.06
208 0.07
209 0.08
210 0.08
211 0.07
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.05
236 0.06
237 0.07
238 0.07
239 0.07
240 0.07
241 0.07
242 0.08
243 0.09
244 0.15
245 0.18
246 0.22
247 0.29
248 0.31
249 0.32
250 0.31
251 0.31
252 0.24
253 0.21
254 0.17
255 0.12
256 0.11
257 0.11
258 0.13
259 0.12
260 0.13
261 0.13
262 0.14
263 0.13
264 0.13
265 0.13
266 0.13
267 0.19
268 0.2
269 0.25
270 0.28
271 0.29
272 0.29
273 0.33
274 0.35
275 0.36
276 0.37
277 0.36
278 0.31
279 0.29
280 0.29
281 0.27
282 0.26
283 0.22
284 0.19
285 0.15
286 0.15
287 0.17
288 0.18
289 0.2
290 0.19
291 0.16
292 0.15
293 0.16
294 0.17
295 0.19
296 0.19
297 0.17
298 0.18
299 0.2
300 0.23
301 0.27
302 0.34
303 0.34
304 0.35
305 0.39
306 0.37
307 0.4
308 0.43
309 0.47
310 0.49
311 0.54
312 0.59
313 0.63
314 0.64
315 0.59
316 0.57
317 0.49
318 0.4
319 0.35
320 0.37
321 0.36
322 0.4
323 0.42
324 0.43
325 0.43
326 0.5
327 0.5
328 0.51
329 0.53
330 0.55
331 0.61
332 0.69
333 0.78
334 0.78
335 0.81
336 0.78
337 0.73
338 0.75
339 0.76
340 0.74
341 0.69
342 0.61
343 0.55
344 0.49
345 0.47
346 0.44
347 0.42
348 0.39
349 0.43
350 0.47
351 0.47