Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UX51

Protein Details
Accession A0A1L9UX51    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
14-40LWKIPWRLSQPQKARQRKRLRGVDRVVHydrophilic
74-103DKYTLFDKKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
81-95KKEKKYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MMFKPSSPLFSGLLWKIPWRLSQPQKARQRKRLRGVDRVVDTVSAALERNGYTTKAVERWYREMPREEEMLPKDKYTLFDKKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.25
5 0.28
6 0.28
7 0.36
8 0.41
9 0.51
10 0.58
11 0.64
12 0.73
13 0.8
14 0.84
15 0.84
16 0.87
17 0.87
18 0.88
19 0.89
20 0.84
21 0.83
22 0.79
23 0.76
24 0.67
25 0.59
26 0.48
27 0.38
28 0.31
29 0.22
30 0.16
31 0.09
32 0.07
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.07
39 0.08
40 0.08
41 0.09
42 0.11
43 0.14
44 0.16
45 0.19
46 0.23
47 0.29
48 0.32
49 0.34
50 0.37
51 0.36
52 0.36
53 0.35
54 0.31
55 0.3
56 0.29
57 0.31
58 0.27
59 0.25
60 0.24
61 0.23
62 0.25
63 0.26
64 0.32
65 0.31
66 0.39
67 0.47
68 0.55
69 0.64
70 0.7
71 0.71
72 0.73
73 0.79
74 0.81
75 0.84
76 0.85
77 0.86
78 0.85
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.77
88 0.79