Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9US62

Protein Details
Accession A0A1L9US62   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
243-268GERFVRMSHRIPRRRRKAITAVRVLDHydrophilic
NLS Segment(s)
PositionSequence
252-259RIPRRRRK
Subcellular Location(s) mito 11, nucl 8, cyto 4, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029062  Class_I_gatase-like  
IPR032633  ThiJ-like  
Pfam View protein in Pfam  
PF17124  ThiJ_like  
CDD cd03141  GATase1_Hsp31_like  
Amino Acid Sequences MPTKKVLIILSDATSFPLHNTSSGTQQQPTGFFLPELAKPLSKLLSAGHEVTFASPKGLTPKPDPNSESLLAFAGNFYERKREQELIERMRRENGFSSPRPFASISDEELKSFAAVFIPGGHAPLVDLGGDKELGRILRYFHGENKPTAAICHGPLALLSTRVTSEGNDSGEFAYKGYEITCWSDAEEKVMETLLRGEIEKCESQLRDAGAVMVEGGREKLGKTTLCRELLTGGNPLAAEELGERFVRMSHRIPRRRRKAITAVRVLDHARVVRGHGTPVSVAGHEGGRGSGEGEEDGFEMHFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.15
4 0.16
5 0.15
6 0.14
7 0.18
8 0.18
9 0.25
10 0.31
11 0.33
12 0.31
13 0.34
14 0.35
15 0.33
16 0.36
17 0.31
18 0.25
19 0.22
20 0.23
21 0.23
22 0.21
23 0.24
24 0.22
25 0.2
26 0.2
27 0.23
28 0.22
29 0.19
30 0.19
31 0.15
32 0.19
33 0.21
34 0.22
35 0.2
36 0.19
37 0.18
38 0.19
39 0.2
40 0.15
41 0.13
42 0.12
43 0.12
44 0.18
45 0.22
46 0.24
47 0.28
48 0.38
49 0.4
50 0.47
51 0.47
52 0.44
53 0.47
54 0.43
55 0.37
56 0.28
57 0.25
58 0.18
59 0.16
60 0.13
61 0.08
62 0.08
63 0.09
64 0.09
65 0.16
66 0.17
67 0.21
68 0.26
69 0.28
70 0.29
71 0.38
72 0.47
73 0.49
74 0.56
75 0.54
76 0.51
77 0.53
78 0.51
79 0.44
80 0.37
81 0.34
82 0.35
83 0.35
84 0.39
85 0.35
86 0.35
87 0.35
88 0.33
89 0.27
90 0.27
91 0.25
92 0.24
93 0.27
94 0.27
95 0.24
96 0.23
97 0.22
98 0.15
99 0.13
100 0.1
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.07
108 0.07
109 0.06
110 0.06
111 0.06
112 0.06
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.07
123 0.07
124 0.08
125 0.11
126 0.14
127 0.15
128 0.2
129 0.26
130 0.27
131 0.27
132 0.28
133 0.26
134 0.23
135 0.22
136 0.17
137 0.12
138 0.1
139 0.11
140 0.09
141 0.08
142 0.08
143 0.1
144 0.08
145 0.08
146 0.08
147 0.07
148 0.07
149 0.08
150 0.08
151 0.07
152 0.09
153 0.1
154 0.11
155 0.11
156 0.11
157 0.11
158 0.12
159 0.12
160 0.09
161 0.08
162 0.07
163 0.07
164 0.06
165 0.07
166 0.07
167 0.1
168 0.11
169 0.1
170 0.11
171 0.15
172 0.14
173 0.16
174 0.15
175 0.12
176 0.11
177 0.11
178 0.1
179 0.07
180 0.08
181 0.07
182 0.07
183 0.07
184 0.08
185 0.09
186 0.13
187 0.13
188 0.13
189 0.16
190 0.16
191 0.16
192 0.19
193 0.18
194 0.15
195 0.15
196 0.14
197 0.1
198 0.1
199 0.09
200 0.06
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.08
208 0.11
209 0.14
210 0.17
211 0.24
212 0.3
213 0.33
214 0.33
215 0.31
216 0.3
217 0.3
218 0.28
219 0.24
220 0.17
221 0.16
222 0.15
223 0.15
224 0.12
225 0.1
226 0.08
227 0.06
228 0.07
229 0.08
230 0.09
231 0.09
232 0.08
233 0.1
234 0.13
235 0.16
236 0.22
237 0.29
238 0.4
239 0.5
240 0.6
241 0.7
242 0.77
243 0.84
244 0.84
245 0.83
246 0.84
247 0.85
248 0.84
249 0.82
250 0.75
251 0.66
252 0.63
253 0.56
254 0.46
255 0.39
256 0.3
257 0.23
258 0.2
259 0.22
260 0.23
261 0.23
262 0.24
263 0.21
264 0.21
265 0.19
266 0.21
267 0.2
268 0.15
269 0.15
270 0.13
271 0.13
272 0.12
273 0.12
274 0.1
275 0.09
276 0.09
277 0.09
278 0.09
279 0.09
280 0.09
281 0.09
282 0.1
283 0.09
284 0.09