Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VAX4

Protein Details
Accession G0VAX4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
141-170KVPKAGMTDKKQNGKKRKKTTKKVKLPKEKBasic
NLS Segment(s)
PositionSequence
150-170KKQNGKKRKKTTKKVKLPKEK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0006366  P:transcription by RNA polymerase II  
KEGG ncs:NCAS_0B00120  -  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MSRRLKRTNLFSKDMSSLLYAYGDVPQPLPQTVQCLDELVSSYLVDICNAAYQSAKNSQRNKLKIEDFKFALRNDPIKLGRAEELIATNKLITEAKKQFNETDNQSLKRYRADGEEEEELNDEDLDENENENENENETELKVPKAGMTDKKQNGKKRKKTTKKVKLPKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.39
3 0.3
4 0.23
5 0.18
6 0.16
7 0.12
8 0.1
9 0.12
10 0.12
11 0.11
12 0.11
13 0.13
14 0.15
15 0.15
16 0.16
17 0.14
18 0.18
19 0.18
20 0.2
21 0.17
22 0.16
23 0.16
24 0.15
25 0.17
26 0.13
27 0.12
28 0.1
29 0.1
30 0.1
31 0.1
32 0.09
33 0.07
34 0.06
35 0.07
36 0.08
37 0.08
38 0.07
39 0.07
40 0.11
41 0.19
42 0.26
43 0.31
44 0.37
45 0.45
46 0.53
47 0.57
48 0.57
49 0.55
50 0.56
51 0.57
52 0.56
53 0.53
54 0.46
55 0.45
56 0.45
57 0.38
58 0.35
59 0.29
60 0.27
61 0.23
62 0.26
63 0.24
64 0.23
65 0.23
66 0.2
67 0.18
68 0.16
69 0.15
70 0.11
71 0.12
72 0.11
73 0.11
74 0.09
75 0.08
76 0.08
77 0.08
78 0.09
79 0.08
80 0.15
81 0.21
82 0.26
83 0.28
84 0.29
85 0.31
86 0.33
87 0.36
88 0.33
89 0.36
90 0.35
91 0.36
92 0.37
93 0.37
94 0.35
95 0.33
96 0.31
97 0.23
98 0.22
99 0.25
100 0.24
101 0.26
102 0.28
103 0.25
104 0.24
105 0.24
106 0.2
107 0.15
108 0.13
109 0.09
110 0.06
111 0.06
112 0.08
113 0.07
114 0.08
115 0.08
116 0.1
117 0.1
118 0.12
119 0.12
120 0.12
121 0.12
122 0.12
123 0.12
124 0.11
125 0.15
126 0.15
127 0.15
128 0.14
129 0.14
130 0.14
131 0.18
132 0.23
133 0.28
134 0.34
135 0.44
136 0.5
137 0.6
138 0.67
139 0.73
140 0.78
141 0.8
142 0.84
143 0.85
144 0.89
145 0.91
146 0.94
147 0.96
148 0.96
149 0.96
150 0.96