Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0V5P6

Protein Details
Accession G0V5P6    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-51MPQKALKVTKKAKDPRRVTKKQKNLRPAAPLQLKSKKKSLQHLKKLNRTASHydrophilic
NLS Segment(s)
PositionSequence
7-44KVTKKAKDPRRVTKKQKNLRPAAPLQLKSKKKSLQHLK
73-87TRKELEKKAKNGAKK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG ncs:NCAS_0A02260  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKALKVTKKAKDPRRVTKKQKNLRPAAPLQLKSKKKSLQHLKKLNRTASLTETTEKLIASRVGHLELLKGTRKELEKKAKNGAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.85
4 0.89
5 0.89
6 0.9
7 0.91
8 0.9
9 0.9
10 0.89
11 0.86
12 0.81
13 0.77
14 0.69
15 0.68
16 0.64
17 0.59
18 0.56
19 0.58
20 0.57
21 0.53
22 0.57
23 0.53
24 0.51
25 0.58
26 0.62
27 0.63
28 0.68
29 0.75
30 0.77
31 0.79
32 0.81
33 0.73
34 0.65
35 0.56
36 0.48
37 0.42
38 0.37
39 0.31
40 0.25
41 0.24
42 0.21
43 0.19
44 0.17
45 0.13
46 0.11
47 0.12
48 0.12
49 0.14
50 0.14
51 0.15
52 0.16
53 0.16
54 0.15
55 0.15
56 0.18
57 0.21
58 0.2
59 0.2
60 0.25
61 0.31
62 0.37
63 0.45
64 0.52
65 0.55
66 0.61
67 0.71