Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9U247

Protein Details
Accession A0A1L9U247   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-53GADQKALKQKPSKKNRLKKSVFRKAAQHydrophilic
NLS Segment(s)
PositionSequence
25-49RKGADQKALKQKPSKKNRLKKSVFR
Subcellular Location(s) nucl 12.5, mito_nucl 11, mito 8.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MVLSPSYLADGPYTRIPWPRKFDYRKGADQKALKQKPSKKNRLKKSVFRKAAQYSLECESDVFVMIRTRRNGQRFVFNSSVSERWLPSMQELVSGDRSVLQSHCNLNEDRMNTIPYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.28
3 0.34
4 0.41
5 0.47
6 0.52
7 0.59
8 0.65
9 0.71
10 0.73
11 0.74
12 0.76
13 0.76
14 0.73
15 0.69
16 0.67
17 0.67
18 0.68
19 0.66
20 0.62
21 0.62
22 0.66
23 0.7
24 0.75
25 0.77
26 0.77
27 0.82
28 0.87
29 0.89
30 0.88
31 0.87
32 0.87
33 0.87
34 0.83
35 0.75
36 0.71
37 0.64
38 0.6
39 0.53
40 0.43
41 0.34
42 0.3
43 0.29
44 0.22
45 0.18
46 0.13
47 0.11
48 0.11
49 0.08
50 0.06
51 0.08
52 0.1
53 0.14
54 0.15
55 0.2
56 0.27
57 0.3
58 0.36
59 0.35
60 0.43
61 0.41
62 0.47
63 0.44
64 0.38
65 0.36
66 0.33
67 0.32
68 0.24
69 0.23
70 0.17
71 0.17
72 0.19
73 0.17
74 0.16
75 0.18
76 0.16
77 0.18
78 0.19
79 0.19
80 0.19
81 0.19
82 0.17
83 0.16
84 0.17
85 0.15
86 0.15
87 0.14
88 0.16
89 0.2
90 0.23
91 0.24
92 0.24
93 0.27
94 0.32
95 0.31
96 0.31
97 0.29