Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UL53

Protein Details
Accession A0A1L9UL53   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-91RTQEPEEKEKKKERKKERKKENKENKSYHSRPIBasic
NLS Segment(s)
PositionSequence
63-84PEEKEKKKERKKERKKENKENK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MLHYQPLSNVYQCKVSVHEMMSSFLYTKCKGLNHNHPIMQSTLNMRGKRREGSGNPVIRTQEPEEKEKKKERKKERKKENKENKSYHSRPIALPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.26
4 0.24
5 0.26
6 0.23
7 0.24
8 0.23
9 0.21
10 0.18
11 0.16
12 0.18
13 0.15
14 0.16
15 0.17
16 0.19
17 0.24
18 0.31
19 0.4
20 0.44
21 0.49
22 0.49
23 0.47
24 0.46
25 0.41
26 0.34
27 0.24
28 0.19
29 0.22
30 0.26
31 0.27
32 0.27
33 0.31
34 0.32
35 0.33
36 0.33
37 0.32
38 0.28
39 0.34
40 0.41
41 0.42
42 0.4
43 0.4
44 0.39
45 0.32
46 0.34
47 0.3
48 0.29
49 0.27
50 0.32
51 0.38
52 0.42
53 0.49
54 0.55
55 0.62
56 0.65
57 0.72
58 0.78
59 0.81
60 0.88
61 0.91
62 0.93
63 0.94
64 0.95
65 0.96
66 0.96
67 0.96
68 0.95
69 0.91
70 0.88
71 0.88
72 0.8
73 0.77
74 0.74
75 0.67