Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UQL1

Protein Details
Accession A0A1L9UQL1   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSSPQSSSKRKRSGSQHLSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041723  CCT  
IPR004821  Cyt_trans-like  
IPR045049  Pcy1-like  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0004105  F:choline-phosphate cytidylyltransferase activity  
Pfam View protein in Pfam  
PF01467  CTP_transf_like  
CDD cd02174  CCT  
Amino Acid Sequences MSSPQSSSKRKRSGSQHLSANAAIPSPAELLQPSSRDASGEEGDESTGSAIPLPSKHKKQSSLDVTSAGTVPPPKRARKASASEGRVPASNGDLPDAPSAVSKEDPGEPSETTVASSDIESRSKSRPGLQVNTSEPLMSPPERAGLQDPVGYHTNPPPTGRPVRVYADGVFDLFHVGHMRQLEQAKKAFPDVHLIVGVTGDEETHKRKGLTVLSGAERAESIRHCRWVDEVIPNCPWIVTPEFIDEHQIDYVAHDDLPYGADEGDDIYAPIKAQGKFLATQRTEGVSTTGIITRIVRDYDQYISRQFKRGASRQELNVSWLKKNELEIKRHVAELRDSIRSNWTTTGQELGRELRQFWQNSRPNSPLSSARNSVDLGGTRSGVTSPTLGSKAHVSRVEALGRPESTIGNGRNEPDFATGYSLGLIGGVRAWVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.78
4 0.71
5 0.69
6 0.6
7 0.52
8 0.41
9 0.32
10 0.24
11 0.16
12 0.14
13 0.12
14 0.13
15 0.11
16 0.11
17 0.15
18 0.19
19 0.2
20 0.21
21 0.22
22 0.21
23 0.21
24 0.21
25 0.22
26 0.19
27 0.19
28 0.18
29 0.16
30 0.16
31 0.15
32 0.15
33 0.11
34 0.09
35 0.08
36 0.08
37 0.08
38 0.1
39 0.14
40 0.22
41 0.3
42 0.38
43 0.47
44 0.53
45 0.6
46 0.65
47 0.71
48 0.73
49 0.7
50 0.64
51 0.57
52 0.5
53 0.44
54 0.38
55 0.27
56 0.2
57 0.19
58 0.18
59 0.26
60 0.33
61 0.38
62 0.46
63 0.52
64 0.58
65 0.61
66 0.67
67 0.68
68 0.7
69 0.7
70 0.68
71 0.64
72 0.58
73 0.5
74 0.44
75 0.34
76 0.28
77 0.25
78 0.18
79 0.17
80 0.17
81 0.17
82 0.17
83 0.17
84 0.13
85 0.12
86 0.12
87 0.12
88 0.12
89 0.11
90 0.12
91 0.15
92 0.17
93 0.17
94 0.19
95 0.17
96 0.19
97 0.19
98 0.17
99 0.14
100 0.13
101 0.12
102 0.1
103 0.1
104 0.11
105 0.12
106 0.14
107 0.15
108 0.17
109 0.2
110 0.24
111 0.25
112 0.28
113 0.34
114 0.39
115 0.44
116 0.44
117 0.46
118 0.45
119 0.45
120 0.39
121 0.32
122 0.25
123 0.21
124 0.21
125 0.16
126 0.14
127 0.12
128 0.14
129 0.14
130 0.15
131 0.16
132 0.15
133 0.15
134 0.16
135 0.16
136 0.17
137 0.19
138 0.19
139 0.18
140 0.19
141 0.22
142 0.21
143 0.23
144 0.22
145 0.27
146 0.32
147 0.33
148 0.32
149 0.32
150 0.34
151 0.35
152 0.34
153 0.28
154 0.26
155 0.23
156 0.2
157 0.16
158 0.12
159 0.11
160 0.08
161 0.08
162 0.06
163 0.06
164 0.08
165 0.09
166 0.09
167 0.12
168 0.16
169 0.18
170 0.21
171 0.23
172 0.22
173 0.22
174 0.24
175 0.21
176 0.18
177 0.22
178 0.19
179 0.18
180 0.16
181 0.16
182 0.13
183 0.12
184 0.11
185 0.05
186 0.04
187 0.03
188 0.04
189 0.06
190 0.09
191 0.1
192 0.12
193 0.12
194 0.13
195 0.17
196 0.19
197 0.2
198 0.19
199 0.2
200 0.2
201 0.21
202 0.19
203 0.16
204 0.13
205 0.11
206 0.1
207 0.09
208 0.13
209 0.14
210 0.19
211 0.19
212 0.2
213 0.21
214 0.22
215 0.24
216 0.25
217 0.25
218 0.24
219 0.24
220 0.24
221 0.22
222 0.2
223 0.16
224 0.12
225 0.12
226 0.09
227 0.1
228 0.12
229 0.12
230 0.13
231 0.15
232 0.13
233 0.12
234 0.11
235 0.11
236 0.09
237 0.08
238 0.09
239 0.07
240 0.07
241 0.05
242 0.06
243 0.05
244 0.06
245 0.06
246 0.05
247 0.05
248 0.05
249 0.05
250 0.05
251 0.05
252 0.04
253 0.04
254 0.04
255 0.05
256 0.05
257 0.07
258 0.12
259 0.12
260 0.13
261 0.15
262 0.17
263 0.19
264 0.23
265 0.29
266 0.25
267 0.26
268 0.26
269 0.26
270 0.25
271 0.22
272 0.2
273 0.12
274 0.12
275 0.11
276 0.12
277 0.1
278 0.1
279 0.1
280 0.11
281 0.12
282 0.13
283 0.12
284 0.12
285 0.14
286 0.17
287 0.2
288 0.2
289 0.24
290 0.3
291 0.32
292 0.37
293 0.37
294 0.39
295 0.45
296 0.5
297 0.53
298 0.54
299 0.56
300 0.54
301 0.57
302 0.52
303 0.48
304 0.46
305 0.4
306 0.34
307 0.32
308 0.3
309 0.26
310 0.3
311 0.36
312 0.37
313 0.4
314 0.43
315 0.48
316 0.47
317 0.48
318 0.46
319 0.38
320 0.35
321 0.36
322 0.34
323 0.32
324 0.32
325 0.31
326 0.36
327 0.34
328 0.33
329 0.29
330 0.28
331 0.24
332 0.24
333 0.29
334 0.23
335 0.23
336 0.23
337 0.24
338 0.25
339 0.25
340 0.25
341 0.25
342 0.31
343 0.33
344 0.35
345 0.42
346 0.44
347 0.49
348 0.54
349 0.51
350 0.47
351 0.47
352 0.47
353 0.45
354 0.44
355 0.45
356 0.42
357 0.4
358 0.39
359 0.37
360 0.34
361 0.29
362 0.25
363 0.22
364 0.2
365 0.19
366 0.17
367 0.17
368 0.16
369 0.14
370 0.13
371 0.11
372 0.11
373 0.14
374 0.16
375 0.16
376 0.17
377 0.23
378 0.25
379 0.31
380 0.33
381 0.31
382 0.34
383 0.38
384 0.42
385 0.37
386 0.37
387 0.35
388 0.33
389 0.31
390 0.28
391 0.24
392 0.23
393 0.27
394 0.27
395 0.29
396 0.31
397 0.32
398 0.33
399 0.33
400 0.31
401 0.27
402 0.25
403 0.2
404 0.22
405 0.2
406 0.18
407 0.18
408 0.16
409 0.13
410 0.12
411 0.11
412 0.06
413 0.06
414 0.06