Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UPA6

Protein Details
Accession A0A1L9UPA6    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-30RVSFAQFQPHAKKKRRKRKTGKNISSGIRHydrophilic
NLS Segment(s)
PositionSequence
12-55AKKKRRKRKTGKNISSGIRAISDKMKASQGEKVGEKGRQRKFGT
70-90KSGREVKWGEKREREREREAG
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MRVSFAQFQPHAKKKRRKRKTGKNISSGIRAISDKMKASQGEKVGEKGRQRKFGTSGGDGGKEGFMEAQKSGREVKWGEKREREREREAGESDRKLREKTMEAIGEDRIDLFEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.86
3 0.89
4 0.91
5 0.92
6 0.94
7 0.95
8 0.96
9 0.95
10 0.92
11 0.88
12 0.8
13 0.74
14 0.63
15 0.52
16 0.43
17 0.33
18 0.27
19 0.23
20 0.22
21 0.18
22 0.19
23 0.22
24 0.2
25 0.22
26 0.24
27 0.24
28 0.25
29 0.25
30 0.27
31 0.26
32 0.29
33 0.34
34 0.38
35 0.4
36 0.45
37 0.46
38 0.46
39 0.47
40 0.48
41 0.45
42 0.38
43 0.36
44 0.28
45 0.27
46 0.23
47 0.2
48 0.14
49 0.1
50 0.09
51 0.06
52 0.05
53 0.06
54 0.06
55 0.08
56 0.08
57 0.1
58 0.13
59 0.12
60 0.16
61 0.16
62 0.25
63 0.32
64 0.4
65 0.45
66 0.51
67 0.59
68 0.66
69 0.74
70 0.71
71 0.68
72 0.68
73 0.65
74 0.61
75 0.56
76 0.53
77 0.49
78 0.48
79 0.46
80 0.47
81 0.45
82 0.42
83 0.42
84 0.4
85 0.39
86 0.38
87 0.42
88 0.38
89 0.36
90 0.37
91 0.35
92 0.3
93 0.26
94 0.22
95 0.15