Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0V7L9

Protein Details
Accession G0V7L9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-57GKPSSGKEKVKSKRQRLKNAINDPNLHydrophilic
NLS Segment(s)
PositionSequence
33-48KPSSGKEKVKSKRQRL
Subcellular Location(s) E.R. 9, cyto 8.5, cyto_nucl 7, extr 5, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ncs:NCAS_0A09090  -  
Amino Acid Sequences MELVAYFIVLFVVILFLVILPILGNVGNFKIGKPSSGKEKVKSKRQRLKNAINDPNLLKFKLKDEDTKGASSANKFQLDSKTGLKRRVLGNSDNQDPNAFDYDIDELINEDRLEEEAEEAKRVGKFKGKERETYEALV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.05
13 0.05
14 0.09
15 0.09
16 0.09
17 0.15
18 0.15
19 0.18
20 0.21
21 0.23
22 0.3
23 0.39
24 0.43
25 0.44
26 0.54
27 0.6
28 0.67
29 0.75
30 0.76
31 0.76
32 0.82
33 0.86
34 0.86
35 0.88
36 0.87
37 0.87
38 0.83
39 0.76
40 0.68
41 0.58
42 0.55
43 0.46
44 0.36
45 0.27
46 0.2
47 0.21
48 0.24
49 0.25
50 0.24
51 0.27
52 0.32
53 0.33
54 0.33
55 0.3
56 0.26
57 0.25
58 0.22
59 0.22
60 0.21
61 0.19
62 0.19
63 0.21
64 0.23
65 0.24
66 0.26
67 0.26
68 0.3
69 0.33
70 0.37
71 0.37
72 0.38
73 0.38
74 0.43
75 0.41
76 0.36
77 0.41
78 0.41
79 0.45
80 0.42
81 0.39
82 0.33
83 0.29
84 0.28
85 0.22
86 0.18
87 0.12
88 0.12
89 0.13
90 0.13
91 0.12
92 0.1
93 0.08
94 0.08
95 0.11
96 0.09
97 0.07
98 0.08
99 0.09
100 0.1
101 0.09
102 0.1
103 0.13
104 0.14
105 0.15
106 0.15
107 0.18
108 0.19
109 0.21
110 0.23
111 0.26
112 0.31
113 0.4
114 0.51
115 0.52
116 0.57
117 0.63
118 0.67