Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9UGD0

Protein Details
Accession A0A1L9UGD0    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-97ERDKKFPGERLWKKGRRKLLIEGWKRKEBasic
NLS Segment(s)
PositionSequence
17-37GARGKGLSRTVQGSRRRNGRG
69-98PERDKKFPGERLWKKGRRKLLIEGWKRKEG
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences MGVWMGEVESRERDKSGARGKGLSRTVQGSRRRNGRGLKYSGRERQGEWASQEFPGINPTNEFTRKEWPERDKKFPGERLWKKGRRKLLIEGWKRKEGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.3
3 0.37
4 0.39
5 0.38
6 0.42
7 0.43
8 0.5
9 0.5
10 0.43
11 0.36
12 0.34
13 0.37
14 0.4
15 0.47
16 0.47
17 0.5
18 0.56
19 0.57
20 0.58
21 0.61
22 0.62
23 0.6
24 0.6
25 0.6
26 0.57
27 0.61
28 0.61
29 0.58
30 0.5
31 0.43
32 0.44
33 0.4
34 0.35
35 0.3
36 0.26
37 0.23
38 0.21
39 0.21
40 0.13
41 0.11
42 0.14
43 0.13
44 0.11
45 0.11
46 0.12
47 0.16
48 0.19
49 0.21
50 0.19
51 0.27
52 0.31
53 0.36
54 0.42
55 0.47
56 0.55
57 0.59
58 0.66
59 0.64
60 0.68
61 0.7
62 0.69
63 0.7
64 0.7
65 0.72
66 0.73
67 0.77
68 0.78
69 0.8
70 0.81
71 0.82
72 0.79
73 0.76
74 0.75
75 0.75
76 0.77
77 0.78
78 0.8
79 0.77