Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9U4I6

Protein Details
Accession A0A1L9U4I6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-68IYSSNGKQNKTKKQKAKKKHYSKSKSGVRCHydrophilic
NLS Segment(s)
PositionSequence
47-63NKTKKQKAKKKHYSKSK
Subcellular Location(s) mito 24.5, mito_nucl 14
Family & Domain DBs
Amino Acid Sequences MGRGFKLLRMGLCVMKIVNGLQVPGAVVTSSSFRTISSIYSSNGKQNKTKKQKAKKKHYSKSKSGVRCSFMESLGWIQPSCFDNSSLPGKAINLIGCGCFVQLIHTVQRLGRRKMKYCHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.13
5 0.14
6 0.12
7 0.12
8 0.11
9 0.11
10 0.1
11 0.09
12 0.09
13 0.05
14 0.05
15 0.05
16 0.07
17 0.08
18 0.09
19 0.09
20 0.09
21 0.1
22 0.11
23 0.12
24 0.14
25 0.15
26 0.15
27 0.19
28 0.2
29 0.25
30 0.29
31 0.3
32 0.33
33 0.39
34 0.49
35 0.56
36 0.64
37 0.68
38 0.74
39 0.82
40 0.86
41 0.89
42 0.9
43 0.9
44 0.9
45 0.91
46 0.88
47 0.85
48 0.84
49 0.82
50 0.77
51 0.74
52 0.69
53 0.61
54 0.54
55 0.5
56 0.42
57 0.33
58 0.26
59 0.2
60 0.18
61 0.16
62 0.16
63 0.11
64 0.1
65 0.12
66 0.14
67 0.16
68 0.14
69 0.14
70 0.14
71 0.18
72 0.23
73 0.2
74 0.19
75 0.17
76 0.16
77 0.17
78 0.18
79 0.15
80 0.12
81 0.12
82 0.11
83 0.11
84 0.11
85 0.09
86 0.08
87 0.07
88 0.08
89 0.11
90 0.14
91 0.16
92 0.18
93 0.2
94 0.22
95 0.31
96 0.37
97 0.41
98 0.47
99 0.53
100 0.59