Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9U3C0

Protein Details
Accession A0A1L9U3C0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30PKSPASPKKMMRQKRDRRKKSLLRKAYEYSHydrophilic
NLS Segment(s)
PositionSequence
6-24SPKKMMRQKRDRRKKSLLR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences PKSPASPKKMMRQKRDRRKKSLLRKAYEYSKLCDADVCLGIRIRESGQVTTFLSDPTGFWSGLSSQLEIYYPRPIQKTEKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.92
3 0.91
4 0.9
5 0.92
6 0.91
7 0.91
8 0.91
9 0.89
10 0.84
11 0.81
12 0.77
13 0.73
14 0.71
15 0.62
16 0.54
17 0.5
18 0.44
19 0.38
20 0.32
21 0.26
22 0.19
23 0.19
24 0.16
25 0.11
26 0.11
27 0.11
28 0.1
29 0.1
30 0.09
31 0.11
32 0.12
33 0.12
34 0.12
35 0.14
36 0.14
37 0.15
38 0.15
39 0.11
40 0.1
41 0.09
42 0.09
43 0.11
44 0.13
45 0.11
46 0.11
47 0.12
48 0.12
49 0.17
50 0.18
51 0.15
52 0.13
53 0.14
54 0.15
55 0.15
56 0.16
57 0.19
58 0.2
59 0.25
60 0.27
61 0.3