Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UWY6

Protein Details
Accession A0A1L9UWY6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-82RAEPPVDGVKKRKKRNRWGDAQENKAAHydrophilic
NLS Segment(s)
PositionSequence
51-72GRSPVRAEPPVDGVKKRKKRNR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045071  BBP-like  
IPR032570  SF1-HH  
IPR047086  SF1-HH_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0045131  F:pre-mRNA branch point binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF16275  SF1-HH  
Amino Acid Sequences MAWRNQGITGSNNIPLGRRRFGGDDGPEEEESRTATPASMPSAGDSAYKRGRSPVRAEPPVDGVKKRKKRNRWGDAQENKAAGLMGLPTMIMANFTNEQLEAYTLHLRIEEISQKLRINDVVPADGDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYRRPTKTQEKVYVPVNDYPEINFSMITNPLTPNHCCTCTLLHSLTLLCSSRASDEDFAAGRCLSPARFLRTLCSTCSFALSSFAPFFCSHSPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.35
4 0.33
5 0.32
6 0.33
7 0.34
8 0.37
9 0.42
10 0.39
11 0.38
12 0.38
13 0.4
14 0.38
15 0.35
16 0.32
17 0.25
18 0.22
19 0.18
20 0.16
21 0.12
22 0.11
23 0.12
24 0.13
25 0.16
26 0.16
27 0.15
28 0.15
29 0.16
30 0.16
31 0.17
32 0.17
33 0.2
34 0.24
35 0.26
36 0.25
37 0.32
38 0.38
39 0.41
40 0.46
41 0.5
42 0.53
43 0.57
44 0.57
45 0.51
46 0.51
47 0.52
48 0.49
49 0.43
50 0.43
51 0.49
52 0.56
53 0.65
54 0.69
55 0.73
56 0.81
57 0.87
58 0.88
59 0.88
60 0.88
61 0.89
62 0.87
63 0.83
64 0.75
65 0.64
66 0.53
67 0.43
68 0.33
69 0.22
70 0.14
71 0.08
72 0.05
73 0.04
74 0.04
75 0.03
76 0.04
77 0.04
78 0.04
79 0.04
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.08
88 0.06
89 0.08
90 0.1
91 0.1
92 0.1
93 0.1
94 0.1
95 0.1
96 0.12
97 0.13
98 0.13
99 0.15
100 0.17
101 0.18
102 0.18
103 0.18
104 0.17
105 0.14
106 0.15
107 0.14
108 0.12
109 0.11
110 0.11
111 0.12
112 0.12
113 0.12
114 0.1
115 0.11
116 0.12
117 0.15
118 0.17
119 0.16
120 0.19
121 0.19
122 0.25
123 0.28
124 0.29
125 0.32
126 0.33
127 0.33
128 0.32
129 0.34
130 0.35
131 0.37
132 0.38
133 0.43
134 0.48
135 0.57
136 0.62
137 0.65
138 0.61
139 0.61
140 0.65
141 0.66
142 0.68
143 0.67
144 0.66
145 0.64
146 0.62
147 0.55
148 0.5
149 0.46
150 0.35
151 0.32
152 0.28
153 0.27
154 0.28
155 0.35
156 0.36
157 0.4
158 0.43
159 0.4
160 0.4
161 0.39
162 0.47
163 0.48
164 0.51
165 0.49
166 0.51
167 0.54
168 0.58
169 0.66
170 0.65
171 0.65
172 0.65
173 0.63
174 0.6
175 0.61
176 0.59
177 0.52
178 0.48
179 0.42
180 0.35
181 0.3
182 0.28
183 0.24
184 0.2
185 0.17
186 0.13
187 0.1
188 0.11
189 0.13
190 0.13
191 0.12
192 0.12
193 0.15
194 0.19
195 0.2
196 0.23
197 0.25
198 0.26
199 0.26
200 0.26
201 0.28
202 0.28
203 0.32
204 0.27
205 0.24
206 0.24
207 0.24
208 0.22
209 0.21
210 0.18
211 0.13
212 0.13
213 0.13
214 0.14
215 0.15
216 0.18
217 0.16
218 0.16
219 0.18
220 0.19
221 0.18
222 0.18
223 0.17
224 0.13
225 0.12
226 0.14
227 0.11
228 0.18
229 0.22
230 0.28
231 0.32
232 0.33
233 0.37
234 0.44
235 0.45
236 0.42
237 0.41
238 0.37
239 0.33
240 0.36
241 0.31
242 0.23
243 0.25
244 0.22
245 0.22
246 0.21
247 0.21
248 0.21
249 0.2
250 0.24