Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VJ09

Protein Details
Accession G0VJ09   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
133-152SANFKGKHTKFNQKDEKKDSHydrophilic
154-175ETMTNRIIKNKKTKGKIVKPSKHydrophilic
NLS Segment(s)
PositionSequence
162-175KNKKTKGKIVKPSK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
KEGG ncs:NCAS_0H01770  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MDTDLQSAKIKPFIQNLHRQLDQLRPTLDSFTSKSLDDQLISTSDEMVKLDLINKYAYVLTSLMFAYMKVLGVKDTKGIAGELARVKEYMSKVTDLKLKLERKLNHVQDEKTRAKELMVSALNRGHDSPAISSANFKGKHTKFNQKDEKKDSLETMTNRIIKNKKTKGKIVKPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.59
4 0.59
5 0.58
6 0.55
7 0.5
8 0.5
9 0.47
10 0.41
11 0.36
12 0.32
13 0.32
14 0.33
15 0.31
16 0.26
17 0.24
18 0.23
19 0.23
20 0.21
21 0.21
22 0.22
23 0.22
24 0.19
25 0.17
26 0.15
27 0.15
28 0.15
29 0.14
30 0.12
31 0.11
32 0.1
33 0.1
34 0.09
35 0.08
36 0.07
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.09
46 0.08
47 0.07
48 0.08
49 0.08
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.07
56 0.06
57 0.06
58 0.07
59 0.08
60 0.08
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.1
74 0.13
75 0.13
76 0.13
77 0.13
78 0.14
79 0.14
80 0.17
81 0.21
82 0.18
83 0.21
84 0.26
85 0.28
86 0.31
87 0.39
88 0.39
89 0.41
90 0.5
91 0.5
92 0.51
93 0.52
94 0.5
95 0.48
96 0.54
97 0.51
98 0.44
99 0.41
100 0.34
101 0.3
102 0.3
103 0.25
104 0.24
105 0.23
106 0.2
107 0.21
108 0.23
109 0.23
110 0.21
111 0.21
112 0.15
113 0.13
114 0.13
115 0.13
116 0.15
117 0.16
118 0.15
119 0.17
120 0.18
121 0.25
122 0.25
123 0.25
124 0.31
125 0.32
126 0.42
127 0.47
128 0.55
129 0.55
130 0.65
131 0.75
132 0.74
133 0.81
134 0.79
135 0.8
136 0.72
137 0.67
138 0.6
139 0.54
140 0.53
141 0.45
142 0.44
143 0.43
144 0.44
145 0.42
146 0.48
147 0.49
148 0.5
149 0.59
150 0.63
151 0.66
152 0.68
153 0.78
154 0.81
155 0.84