Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VF54

Protein Details
Accession G0VF54    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
204-231DEFETFVSKRKKRTNKNKSKYKFEEPVIHydrophilic
NLS Segment(s)
PositionSequence
212-223KRKKRTNKNKSK
Subcellular Location(s) nucl 15.5, cyto_nucl 13.333, cyto 10, cyto_mito 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
KEGG ncs:NCAS_0E00490  -  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MDSAKKILEKKTNNGKISKIKSFEEVLTAYRTTIKDSQMFKDLCEALDSYITDIDRIRCLAIGTFHDDTPAKYQLALLLELVDFIKVKGSRETIPVSIYDPVFSKEDKEYIEGIVDPWTIDERWPTDKDWNSEKTLFFLPHAPLDLTEIILKEETPRFWLANNVIEHTDRYTLLQLFEKYPHIAKLKHLLESQQPAAKITTTNDEFETFVSKRKKRTNKNKSKYKFEEPVINYDSVHTHFKECKILTNFQNGALLKDKEWLNSFSDLTLHLIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.69
4 0.71
5 0.69
6 0.62
7 0.55
8 0.53
9 0.53
10 0.46
11 0.4
12 0.34
13 0.28
14 0.27
15 0.25
16 0.21
17 0.23
18 0.22
19 0.24
20 0.26
21 0.29
22 0.32
23 0.35
24 0.38
25 0.42
26 0.42
27 0.37
28 0.4
29 0.36
30 0.29
31 0.28
32 0.24
33 0.17
34 0.19
35 0.19
36 0.13
37 0.14
38 0.14
39 0.13
40 0.14
41 0.15
42 0.14
43 0.15
44 0.14
45 0.12
46 0.13
47 0.14
48 0.14
49 0.15
50 0.19
51 0.2
52 0.2
53 0.22
54 0.22
55 0.21
56 0.24
57 0.24
58 0.18
59 0.16
60 0.17
61 0.17
62 0.18
63 0.17
64 0.12
65 0.1
66 0.1
67 0.1
68 0.1
69 0.07
70 0.06
71 0.05
72 0.1
73 0.1
74 0.12
75 0.15
76 0.18
77 0.19
78 0.22
79 0.25
80 0.21
81 0.21
82 0.2
83 0.19
84 0.19
85 0.17
86 0.14
87 0.12
88 0.13
89 0.14
90 0.13
91 0.14
92 0.12
93 0.14
94 0.14
95 0.16
96 0.15
97 0.13
98 0.14
99 0.12
100 0.11
101 0.1
102 0.09
103 0.07
104 0.06
105 0.07
106 0.07
107 0.07
108 0.08
109 0.09
110 0.13
111 0.15
112 0.16
113 0.22
114 0.25
115 0.28
116 0.32
117 0.33
118 0.33
119 0.34
120 0.32
121 0.28
122 0.26
123 0.23
124 0.19
125 0.19
126 0.16
127 0.14
128 0.15
129 0.12
130 0.1
131 0.12
132 0.11
133 0.09
134 0.09
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.09
141 0.09
142 0.11
143 0.12
144 0.12
145 0.12
146 0.16
147 0.16
148 0.2
149 0.21
150 0.19
151 0.19
152 0.2
153 0.2
154 0.17
155 0.17
156 0.11
157 0.11
158 0.13
159 0.12
160 0.13
161 0.16
162 0.16
163 0.17
164 0.18
165 0.19
166 0.18
167 0.18
168 0.22
169 0.22
170 0.22
171 0.23
172 0.31
173 0.31
174 0.34
175 0.33
176 0.31
177 0.32
178 0.36
179 0.37
180 0.3
181 0.28
182 0.25
183 0.25
184 0.23
185 0.19
186 0.16
187 0.2
188 0.19
189 0.21
190 0.21
191 0.21
192 0.21
193 0.2
194 0.24
195 0.17
196 0.23
197 0.31
198 0.34
199 0.41
200 0.52
201 0.62
202 0.67
203 0.78
204 0.82
205 0.84
206 0.91
207 0.94
208 0.91
209 0.91
210 0.88
211 0.86
212 0.82
213 0.75
214 0.74
215 0.66
216 0.66
217 0.59
218 0.51
219 0.42
220 0.35
221 0.34
222 0.26
223 0.28
224 0.21
225 0.22
226 0.26
227 0.29
228 0.36
229 0.34
230 0.41
231 0.42
232 0.48
233 0.47
234 0.53
235 0.51
236 0.44
237 0.49
238 0.4
239 0.38
240 0.38
241 0.35
242 0.26
243 0.31
244 0.31
245 0.29
246 0.32
247 0.31
248 0.28
249 0.3
250 0.3
251 0.24
252 0.24
253 0.21