Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9U997

Protein Details
Accession A0A1L9U997   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
143-165DVERPVYERKRTKPHNRELCEGCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MPSRKSNPKSNSKSKSTTLPRNRWSMYPALHIDVLTHLSSDTLSPVALTSLSFHPFDDSHSSKREYDTNIMGRFICTNDSCRSTGWTSKKIAITIRLYEGNEYNARVYHQRCKRCNALSRPFLDEESYAERIAYRMKRWYGVDVERPVYERKRTKPHNRELCEGCKAGRCSFGDVDVDVGDENW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.73
4 0.74
5 0.74
6 0.75
7 0.73
8 0.75
9 0.73
10 0.65
11 0.59
12 0.55
13 0.47
14 0.43
15 0.4
16 0.35
17 0.33
18 0.3
19 0.27
20 0.22
21 0.21
22 0.15
23 0.12
24 0.09
25 0.09
26 0.09
27 0.09
28 0.08
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.09
38 0.12
39 0.12
40 0.12
41 0.14
42 0.14
43 0.17
44 0.21
45 0.23
46 0.24
47 0.27
48 0.3
49 0.29
50 0.31
51 0.32
52 0.28
53 0.28
54 0.31
55 0.33
56 0.31
57 0.31
58 0.29
59 0.26
60 0.23
61 0.2
62 0.16
63 0.11
64 0.14
65 0.15
66 0.18
67 0.18
68 0.18
69 0.21
70 0.2
71 0.27
72 0.28
73 0.3
74 0.29
75 0.33
76 0.33
77 0.32
78 0.31
79 0.29
80 0.26
81 0.23
82 0.23
83 0.21
84 0.2
85 0.2
86 0.19
87 0.16
88 0.15
89 0.14
90 0.12
91 0.11
92 0.12
93 0.15
94 0.17
95 0.24
96 0.3
97 0.39
98 0.42
99 0.47
100 0.53
101 0.57
102 0.63
103 0.63
104 0.65
105 0.62
106 0.62
107 0.6
108 0.54
109 0.48
110 0.39
111 0.3
112 0.24
113 0.23
114 0.22
115 0.17
116 0.16
117 0.15
118 0.15
119 0.21
120 0.22
121 0.2
122 0.26
123 0.27
124 0.32
125 0.33
126 0.37
127 0.37
128 0.39
129 0.43
130 0.4
131 0.41
132 0.37
133 0.38
134 0.39
135 0.38
136 0.41
137 0.42
138 0.46
139 0.54
140 0.64
141 0.73
142 0.78
143 0.84
144 0.86
145 0.84
146 0.83
147 0.79
148 0.75
149 0.7
150 0.6
151 0.52
152 0.49
153 0.47
154 0.41
155 0.41
156 0.36
157 0.36
158 0.36
159 0.36
160 0.3
161 0.27
162 0.27
163 0.2
164 0.19