Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UXJ3

Protein Details
Accession A0A1L9UXJ3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
53-85SSSLRPPNPRGERKSPPFKPSRKSLGPRTPWCWHydrophilic
NLS Segment(s)
PositionSequence
60-76NPRGERKSPPFKPSRKS
Subcellular Location(s) cyto 8.5, cyto_nucl 8, nucl 6.5, plas 4, extr 4, mito 2
Family & Domain DBs
Amino Acid Sequences MTVIFTSLYFLPPIPDSSSPSPATPICPFPVAPFSLHNFSLAPFPSFFLLPSSSSLRPPNPRGERKSPPFKPSRKSLGPRTPWCWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.23
4 0.26
5 0.31
6 0.3
7 0.3
8 0.3
9 0.26
10 0.29
11 0.26
12 0.24
13 0.21
14 0.21
15 0.2
16 0.19
17 0.22
18 0.19
19 0.17
20 0.17
21 0.18
22 0.2
23 0.2
24 0.19
25 0.15
26 0.15
27 0.16
28 0.14
29 0.12
30 0.09
31 0.1
32 0.1
33 0.1
34 0.1
35 0.09
36 0.1
37 0.09
38 0.12
39 0.16
40 0.16
41 0.19
42 0.22
43 0.26
44 0.31
45 0.34
46 0.42
47 0.47
48 0.55
49 0.6
50 0.65
51 0.7
52 0.73
53 0.8
54 0.76
55 0.75
56 0.76
57 0.76
58 0.75
59 0.74
60 0.74
61 0.73
62 0.75
63 0.77
64 0.78
65 0.8
66 0.81