Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UPZ8

Protein Details
Accession A0A1L9UPZ8    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-70TSAIRKEKRIIVKKQKKEEEMKLHRVSHydrophilic
NLS Segment(s)
PositionSequence
49-60KEKRIIVKKQKK
Subcellular Location(s) mito 15, cyto_nucl 6.5, cyto 6, nucl 3, plas 3
Family & Domain DBs
Amino Acid Sequences MPGVLLLFFQQLQAVAVRSGMGYMMLSYYTTVVEEARGQGPYITSAIRKEKRIIVKKQKKEEEMKLHRVSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.08
5 0.08
6 0.07
7 0.06
8 0.05
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.07
23 0.08
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.08
31 0.08
32 0.12
33 0.21
34 0.25
35 0.27
36 0.3
37 0.36
38 0.46
39 0.54
40 0.61
41 0.63
42 0.7
43 0.77
44 0.85
45 0.86
46 0.84
47 0.83
48 0.83
49 0.82
50 0.81
51 0.81
52 0.76