Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9U8W3

Protein Details
Accession A0A1L9U8W3   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-34MTTRANHLRNTSKKRKRKRDKQGTLLVPWHydrophilic
NLS Segment(s)
PositionSequence
17-26SKKRKRKRDK
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MRELQMTTRANHLRNTSKKRKRKRDKQGTLLVPWLTDDRSALPAPHEPVDQPCMLCSWSHFRLIPSRILGTYRHLLIFNRNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.63
3 0.66
4 0.71
5 0.79
6 0.85
7 0.9
8 0.91
9 0.92
10 0.94
11 0.94
12 0.94
13 0.93
14 0.92
15 0.85
16 0.76
17 0.69
18 0.57
19 0.45
20 0.36
21 0.27
22 0.17
23 0.12
24 0.1
25 0.08
26 0.1
27 0.11
28 0.1
29 0.1
30 0.12
31 0.14
32 0.15
33 0.14
34 0.12
35 0.13
36 0.17
37 0.16
38 0.14
39 0.12
40 0.12
41 0.12
42 0.12
43 0.12
44 0.16
45 0.17
46 0.2
47 0.21
48 0.23
49 0.3
50 0.33
51 0.34
52 0.3
53 0.31
54 0.28
55 0.29
56 0.28
57 0.27
58 0.28
59 0.26
60 0.25
61 0.24
62 0.25
63 0.34