Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RVA5

Protein Details
Accession A0A1L9RVA5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-113KECTERRARRAKSHDVPRRKYFVBasic
NLS Segment(s)
PositionSequence
30-34RKHRK
Subcellular Location(s) mito 9cyto 9cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MNRESLIAAGLATVATVHAAHNVYGSVEKRKHRKEMVKTGEMTPEKARKQRVKANLSDAASIGVAALGIKSAVSEWKEADEKYRKKNTFEKECTERRARRAKSHDVPRRKYFVPDEIEETASPERPIISY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.08
6 0.09
7 0.09
8 0.09
9 0.09
10 0.1
11 0.13
12 0.15
13 0.2
14 0.25
15 0.32
16 0.42
17 0.48
18 0.55
19 0.61
20 0.68
21 0.71
22 0.76
23 0.78
24 0.74
25 0.7
26 0.64
27 0.62
28 0.53
29 0.46
30 0.41
31 0.39
32 0.37
33 0.4
34 0.47
35 0.46
36 0.52
37 0.57
38 0.61
39 0.6
40 0.59
41 0.61
42 0.58
43 0.51
44 0.45
45 0.36
46 0.27
47 0.21
48 0.17
49 0.1
50 0.05
51 0.03
52 0.03
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.05
60 0.06
61 0.07
62 0.07
63 0.1
64 0.12
65 0.12
66 0.2
67 0.27
68 0.32
69 0.4
70 0.5
71 0.5
72 0.54
73 0.62
74 0.64
75 0.65
76 0.65
77 0.64
78 0.63
79 0.66
80 0.68
81 0.7
82 0.65
83 0.63
84 0.68
85 0.66
86 0.67
87 0.7
88 0.73
89 0.73
90 0.79
91 0.8
92 0.8
93 0.83
94 0.8
95 0.79
96 0.7
97 0.67
98 0.61
99 0.59
100 0.54
101 0.49
102 0.48
103 0.44
104 0.45
105 0.38
106 0.36
107 0.3
108 0.26
109 0.23
110 0.18