Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VBZ0

Protein Details
Accession G0VBZ0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
279-302AEWEHEVRHHRRRPTRDSNDDSIDBasic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR006940  Securin_separation_inhibitor  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0051276  P:chromosome organization  
KEGG ncs:NCAS_0B03830  -  
Pfam View protein in Pfam  
PF04856  Securin  
Amino Acid Sequences MSLDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNISPRRRQLLQLQNRLPLAKKDNNNSSFSSRKNGLNNIKKLKKYGSVLGMDALPRTKSLILKDVDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEEENEGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDADKLLALETIETSVDDEAEWEHEVRHHRRRPTRDSNDDSIDLVPLYNGEGLDEDDLQDLLADLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.38
4 0.41
5 0.43
6 0.43
7 0.44
8 0.45
9 0.46
10 0.44
11 0.44
12 0.43
13 0.41
14 0.42
15 0.4
16 0.39
17 0.36
18 0.29
19 0.28
20 0.25
21 0.25
22 0.23
23 0.25
24 0.27
25 0.24
26 0.24
27 0.27
28 0.28
29 0.31
30 0.38
31 0.38
32 0.38
33 0.37
34 0.39
35 0.4
36 0.39
37 0.36
38 0.28
39 0.28
40 0.23
41 0.23
42 0.23
43 0.17
44 0.19
45 0.19
46 0.2
47 0.2
48 0.22
49 0.28
50 0.27
51 0.31
52 0.38
53 0.47
54 0.55
55 0.61
56 0.62
57 0.61
58 0.61
59 0.58
60 0.49
61 0.45
62 0.42
63 0.4
64 0.42
65 0.46
66 0.54
67 0.56
68 0.58
69 0.55
70 0.53
71 0.5
72 0.46
73 0.44
74 0.37
75 0.38
76 0.4
77 0.45
78 0.5
79 0.54
80 0.61
81 0.65
82 0.68
83 0.65
84 0.64
85 0.59
86 0.55
87 0.49
88 0.46
89 0.42
90 0.37
91 0.36
92 0.33
93 0.3
94 0.24
95 0.21
96 0.16
97 0.1
98 0.09
99 0.1
100 0.11
101 0.12
102 0.14
103 0.2
104 0.2
105 0.23
106 0.27
107 0.31
108 0.31
109 0.3
110 0.28
111 0.24
112 0.24
113 0.22
114 0.18
115 0.13
116 0.13
117 0.14
118 0.13
119 0.11
120 0.09
121 0.09
122 0.08
123 0.07
124 0.06
125 0.05
126 0.06
127 0.1
128 0.12
129 0.17
130 0.19
131 0.23
132 0.3
133 0.35
134 0.39
135 0.43
136 0.43
137 0.41
138 0.43
139 0.4
140 0.32
141 0.27
142 0.22
143 0.14
144 0.12
145 0.1
146 0.05
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.04
157 0.04
158 0.05
159 0.07
160 0.09
161 0.09
162 0.1
163 0.1
164 0.1
165 0.12
166 0.14
167 0.17
168 0.18
169 0.21
170 0.23
171 0.27
172 0.28
173 0.26
174 0.26
175 0.22
176 0.23
177 0.22
178 0.23
179 0.2
180 0.26
181 0.31
182 0.35
183 0.4
184 0.46
185 0.49
186 0.5
187 0.53
188 0.53
189 0.53
190 0.53
191 0.48
192 0.41
193 0.37
194 0.36
195 0.33
196 0.3
197 0.24
198 0.19
199 0.17
200 0.15
201 0.15
202 0.15
203 0.14
204 0.13
205 0.13
206 0.13
207 0.15
208 0.15
209 0.15
210 0.16
211 0.19
212 0.18
213 0.17
214 0.17
215 0.16
216 0.15
217 0.16
218 0.18
219 0.14
220 0.15
221 0.17
222 0.18
223 0.18
224 0.19
225 0.24
226 0.25
227 0.29
228 0.28
229 0.27
230 0.27
231 0.31
232 0.35
233 0.33
234 0.34
235 0.33
236 0.36
237 0.42
238 0.44
239 0.4
240 0.35
241 0.33
242 0.28
243 0.28
244 0.24
245 0.17
246 0.16
247 0.16
248 0.16
249 0.13
250 0.11
251 0.08
252 0.08
253 0.08
254 0.07
255 0.06
256 0.06
257 0.07
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.06
264 0.06
265 0.06
266 0.08
267 0.09
268 0.09
269 0.09
270 0.13
271 0.22
272 0.3
273 0.4
274 0.46
275 0.55
276 0.64
277 0.73
278 0.79
279 0.82
280 0.85
281 0.84
282 0.85
283 0.81
284 0.78
285 0.69
286 0.61
287 0.5
288 0.4
289 0.3
290 0.22
291 0.15
292 0.09
293 0.09
294 0.09
295 0.08
296 0.08
297 0.08
298 0.1
299 0.12
300 0.12
301 0.11
302 0.1
303 0.1
304 0.1
305 0.09