Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9R667

Protein Details
Accession A0A1L9R667    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-103AASNKNAKRRENKKKAKSAEDHydrophilic
126-154EAESEKKARNLKKKLRQARDLRDKKNQGEBasic
NLS Segment(s)
PositionSequence
87-100KNAKRRENKKKAKS
131-148KKARNLKKKLRQARDLRD
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MAPTNSGITTDSATGERFIPSSVRADGTKRREIRVRPGYRPPEDVELYKNRAAAAWKNRGKGGVPGAESVSNEGDQDTKSSSAASNKNAKRRENKKKAKSAEDGPAPTNGKNPEKTTTAEPPVDAEAESEKKARNLKKKLRQARDLRDKKNQGESLLPEQLDKIIKINELIRQLDTLGFDSNGDKKGEAEGQDNEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.13
5 0.13
6 0.13
7 0.13
8 0.16
9 0.17
10 0.18
11 0.19
12 0.24
13 0.32
14 0.37
15 0.45
16 0.45
17 0.48
18 0.54
19 0.57
20 0.62
21 0.64
22 0.65
23 0.62
24 0.69
25 0.73
26 0.68
27 0.67
28 0.59
29 0.55
30 0.5
31 0.45
32 0.4
33 0.38
34 0.39
35 0.37
36 0.34
37 0.27
38 0.26
39 0.28
40 0.3
41 0.32
42 0.38
43 0.41
44 0.42
45 0.43
46 0.43
47 0.41
48 0.37
49 0.33
50 0.27
51 0.24
52 0.23
53 0.24
54 0.23
55 0.22
56 0.19
57 0.15
58 0.11
59 0.1
60 0.09
61 0.08
62 0.08
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.1
69 0.15
70 0.18
71 0.22
72 0.3
73 0.33
74 0.41
75 0.46
76 0.5
77 0.54
78 0.62
79 0.68
80 0.7
81 0.77
82 0.78
83 0.82
84 0.83
85 0.79
86 0.73
87 0.66
88 0.62
89 0.55
90 0.48
91 0.39
92 0.38
93 0.32
94 0.28
95 0.27
96 0.24
97 0.24
98 0.25
99 0.26
100 0.26
101 0.27
102 0.29
103 0.29
104 0.31
105 0.31
106 0.29
107 0.26
108 0.24
109 0.23
110 0.21
111 0.17
112 0.12
113 0.11
114 0.12
115 0.13
116 0.14
117 0.14
118 0.17
119 0.24
120 0.31
121 0.38
122 0.47
123 0.57
124 0.66
125 0.76
126 0.82
127 0.84
128 0.86
129 0.86
130 0.86
131 0.87
132 0.87
133 0.83
134 0.83
135 0.81
136 0.75
137 0.75
138 0.67
139 0.57
140 0.53
141 0.51
142 0.47
143 0.44
144 0.4
145 0.3
146 0.28
147 0.29
148 0.26
149 0.21
150 0.18
151 0.15
152 0.16
153 0.18
154 0.2
155 0.22
156 0.25
157 0.26
158 0.24
159 0.23
160 0.23
161 0.22
162 0.21
163 0.18
164 0.15
165 0.14
166 0.13
167 0.16
168 0.19
169 0.2
170 0.2
171 0.18
172 0.17
173 0.21
174 0.25
175 0.25
176 0.26
177 0.28