Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9RXY4

Protein Details
Accession A0A1L9RXY4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-43QPPTTSTPKKNKEGRKTRREPYHydrophilic
NLS Segment(s)
PositionSequence
30-39KKNKEGRKTR
Subcellular Location(s) cysk 7, plas 6, cyto_nucl 5.5, cyto 4.5, mito 4, nucl 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASHGDHGSTVIDHLGIPGTSQPPTTSTPKKNKEGRKTRREPYGTRVESMNIICLSSMVEVVILVAIPAILIETRLQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.06
4 0.07
5 0.09
6 0.1
7 0.1
8 0.11
9 0.11
10 0.13
11 0.17
12 0.24
13 0.29
14 0.37
15 0.47
16 0.53
17 0.61
18 0.67
19 0.73
20 0.76
21 0.79
22 0.81
23 0.82
24 0.82
25 0.79
26 0.8
27 0.75
28 0.67
29 0.63
30 0.63
31 0.53
32 0.47
33 0.42
34 0.34
35 0.31
36 0.28
37 0.25
38 0.14
39 0.13
40 0.11
41 0.11
42 0.11
43 0.08
44 0.08
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.04