Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VGT1

Protein Details
Accession G0VGT1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
152-172ENNKEPTPEVKPTRKRTRSKKBasic
NLS Segment(s)
PositionSequence
162-172KPTRKRTRSKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013915  Pre-mRNA_splic_Prp19  
IPR038959  Prp19  
IPR003613  Ubox_domain  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000974  C:Prp19 complex  
GO:0005681  C:spliceosomal complex  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0006281  P:DNA repair  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0070534  P:protein K63-linked ubiquitination  
KEGG ncs:NCAS_0F02180  -  
Pfam View protein in Pfam  
PF08606  Prp19  
CDD cd16656  RING-Ubox_PRP19  
Amino Acid Sequences MFCAISGKPAKVPVVSLKSKCVFEKSLIEQYINETGKDPITNELITKDDLMELSQNPQQTALTNTLNSATLNSNYSIPNLLSTLQNEWDAIMLENFKLRKANDELAKNLSTALYEIDAAKIVAAKAMKERDQIIQELNEVTKAIGMDESDEENNKEPTPEVKPTRKRTRSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.41
4 0.45
5 0.47
6 0.49
7 0.48
8 0.44
9 0.39
10 0.35
11 0.41
12 0.4
13 0.44
14 0.42
15 0.41
16 0.36
17 0.36
18 0.41
19 0.34
20 0.28
21 0.21
22 0.21
23 0.21
24 0.22
25 0.19
26 0.14
27 0.16
28 0.16
29 0.15
30 0.15
31 0.15
32 0.15
33 0.15
34 0.12
35 0.1
36 0.1
37 0.1
38 0.1
39 0.09
40 0.11
41 0.13
42 0.13
43 0.13
44 0.13
45 0.13
46 0.12
47 0.14
48 0.15
49 0.14
50 0.13
51 0.14
52 0.14
53 0.14
54 0.13
55 0.12
56 0.1
57 0.09
58 0.1
59 0.11
60 0.11
61 0.11
62 0.12
63 0.11
64 0.1
65 0.09
66 0.08
67 0.09
68 0.08
69 0.09
70 0.09
71 0.09
72 0.1
73 0.09
74 0.08
75 0.08
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.08
82 0.08
83 0.08
84 0.1
85 0.1
86 0.15
87 0.19
88 0.25
89 0.28
90 0.31
91 0.32
92 0.34
93 0.34
94 0.29
95 0.25
96 0.19
97 0.13
98 0.11
99 0.09
100 0.06
101 0.06
102 0.06
103 0.06
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.07
110 0.08
111 0.08
112 0.13
113 0.17
114 0.19
115 0.21
116 0.23
117 0.25
118 0.27
119 0.28
120 0.26
121 0.22
122 0.22
123 0.21
124 0.19
125 0.15
126 0.13
127 0.11
128 0.1
129 0.09
130 0.08
131 0.07
132 0.07
133 0.09
134 0.1
135 0.13
136 0.13
137 0.15
138 0.16
139 0.18
140 0.2
141 0.19
142 0.18
143 0.17
144 0.2
145 0.25
146 0.32
147 0.39
148 0.47
149 0.57
150 0.67
151 0.77
152 0.82