Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VFC8

Protein Details
Accession G0VFC8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-99LEGISKSSIRRRKRKMREDLKPKMYDBasic
NLS Segment(s)
PositionSequence
81-91SIRRRKRKMRE
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ncs:NCAS_0E01240  -  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MVAKKRNTLRNKAASRAATNGSGSDDHDQSVFDLPPDPKAYLHQARETKKEKQMNKQQNFLERMKMKANGDGNLEGISKSSIRRRKRKMREDLKPKMYDLLTSLQQESDLRDHVLADDRKDDNNEDEMVVDSVTKITKSAAYSHITSGKPMEPGSVIMKKNQPNIRNQKGAKAISQKESARFNQVLTNQSFQQNPFGSLREIIKMQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.64
3 0.58
4 0.51
5 0.43
6 0.38
7 0.32
8 0.27
9 0.23
10 0.22
11 0.22
12 0.19
13 0.17
14 0.17
15 0.16
16 0.15
17 0.17
18 0.15
19 0.11
20 0.16
21 0.16
22 0.21
23 0.23
24 0.23
25 0.2
26 0.23
27 0.31
28 0.34
29 0.37
30 0.41
31 0.46
32 0.49
33 0.58
34 0.6
35 0.59
36 0.6
37 0.65
38 0.63
39 0.66
40 0.73
41 0.75
42 0.74
43 0.74
44 0.69
45 0.68
46 0.68
47 0.58
48 0.56
49 0.47
50 0.45
51 0.41
52 0.42
53 0.35
54 0.35
55 0.35
56 0.29
57 0.3
58 0.27
59 0.24
60 0.2
61 0.2
62 0.13
63 0.11
64 0.1
65 0.08
66 0.1
67 0.17
68 0.24
69 0.33
70 0.44
71 0.54
72 0.64
73 0.74
74 0.82
75 0.85
76 0.88
77 0.89
78 0.9
79 0.89
80 0.86
81 0.77
82 0.66
83 0.59
84 0.48
85 0.38
86 0.3
87 0.23
88 0.17
89 0.16
90 0.16
91 0.13
92 0.13
93 0.13
94 0.12
95 0.11
96 0.09
97 0.08
98 0.08
99 0.08
100 0.09
101 0.15
102 0.15
103 0.15
104 0.18
105 0.19
106 0.2
107 0.21
108 0.22
109 0.17
110 0.18
111 0.17
112 0.13
113 0.12
114 0.12
115 0.11
116 0.1
117 0.07
118 0.05
119 0.06
120 0.06
121 0.06
122 0.05
123 0.06
124 0.08
125 0.1
126 0.13
127 0.16
128 0.19
129 0.2
130 0.22
131 0.28
132 0.26
133 0.25
134 0.25
135 0.22
136 0.21
137 0.2
138 0.19
139 0.13
140 0.15
141 0.2
142 0.24
143 0.23
144 0.26
145 0.33
146 0.36
147 0.44
148 0.49
149 0.47
150 0.51
151 0.61
152 0.65
153 0.67
154 0.64
155 0.63
156 0.63
157 0.62
158 0.58
159 0.57
160 0.53
161 0.49
162 0.55
163 0.51
164 0.48
165 0.53
166 0.48
167 0.46
168 0.42
169 0.38
170 0.38
171 0.39
172 0.4
173 0.38
174 0.39
175 0.34
176 0.37
177 0.38
178 0.33
179 0.37
180 0.32
181 0.32
182 0.31
183 0.3
184 0.29
185 0.3
186 0.31
187 0.26
188 0.28