Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9S2K5

Protein Details
Accession A0A1L9S2K5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MRAKWRKKRVRRLKRKRRKMRLLFFRYRSPSBasic
NLS Segment(s)
PositionSequence
3-21AKWRKKRVRRLKRKRRKMR
Subcellular Location(s) mito 11plas 11, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRAKWRKKRVRRLKRKRRKMRLLFFRYRSPSFNKNYIYFLRVLLSDPLSFAWGLVNFLLLFYLSALVEAGTQNRGEVSFEQLLKIQMIPRVKFSIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.96
7 0.96
8 0.95
9 0.94
10 0.92
11 0.85
12 0.82
13 0.77
14 0.69
15 0.62
16 0.57
17 0.55
18 0.5
19 0.53
20 0.48
21 0.43
22 0.45
23 0.43
24 0.38
25 0.31
26 0.26
27 0.2
28 0.16
29 0.16
30 0.13
31 0.12
32 0.1
33 0.09
34 0.09
35 0.09
36 0.08
37 0.07
38 0.06
39 0.05
40 0.06
41 0.05
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.1
64 0.15
65 0.19
66 0.19
67 0.2
68 0.21
69 0.22
70 0.21
71 0.22
72 0.18
73 0.18
74 0.26
75 0.26
76 0.3