Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0V9X4

Protein Details
Accession G0V9X4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
106-126QLNKIERQKKKSQNNSHHNDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR031783  Csm2  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005634  C:nucleus  
GO:0097196  C:Shu complex  
GO:0000725  P:recombinational repair  
KEGG ncs:NCAS_0B06570  -  
Pfam View protein in Pfam  
PF16834  CSM2  
CDD cd19478  Csm2  
Amino Acid Sequences MLRPCAEKVSRTYGECDMIEINHWDLITAWVSPKKIDLAKFISSALQDQPSQLYFIDATNSFPIREFQRETPVATNKDVYDNIRIITCLELEELTILVNKIIQTIQLNKIERQKKKSQNNSHHNDIQFFPDLKMRVIINGLEIMFKNTQFKQDSETTHSILRDILLRLRVIANESEGTQMQTLLLFPKDEFKISVPVGDTGRYKRMRSNHNGNSLGEYVCKFYADRVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.35
4 0.27
5 0.22
6 0.23
7 0.21
8 0.18
9 0.15
10 0.15
11 0.13
12 0.12
13 0.14
14 0.13
15 0.11
16 0.14
17 0.16
18 0.17
19 0.17
20 0.18
21 0.22
22 0.25
23 0.26
24 0.29
25 0.31
26 0.33
27 0.34
28 0.33
29 0.29
30 0.26
31 0.26
32 0.22
33 0.19
34 0.17
35 0.16
36 0.18
37 0.16
38 0.17
39 0.15
40 0.13
41 0.11
42 0.11
43 0.13
44 0.11
45 0.13
46 0.15
47 0.16
48 0.15
49 0.15
50 0.17
51 0.17
52 0.22
53 0.24
54 0.23
55 0.31
56 0.32
57 0.33
58 0.37
59 0.39
60 0.37
61 0.35
62 0.34
63 0.26
64 0.28
65 0.27
66 0.23
67 0.2
68 0.19
69 0.18
70 0.16
71 0.16
72 0.13
73 0.12
74 0.1
75 0.07
76 0.07
77 0.06
78 0.06
79 0.06
80 0.05
81 0.04
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.11
92 0.16
93 0.2
94 0.22
95 0.24
96 0.33
97 0.4
98 0.43
99 0.46
100 0.52
101 0.56
102 0.64
103 0.72
104 0.75
105 0.77
106 0.83
107 0.82
108 0.78
109 0.74
110 0.64
111 0.56
112 0.46
113 0.38
114 0.31
115 0.25
116 0.2
117 0.18
118 0.18
119 0.16
120 0.17
121 0.14
122 0.12
123 0.12
124 0.12
125 0.09
126 0.09
127 0.09
128 0.08
129 0.09
130 0.11
131 0.11
132 0.11
133 0.14
134 0.13
135 0.19
136 0.2
137 0.21
138 0.23
139 0.27
140 0.3
141 0.34
142 0.36
143 0.32
144 0.32
145 0.32
146 0.27
147 0.22
148 0.2
149 0.15
150 0.14
151 0.15
152 0.15
153 0.15
154 0.16
155 0.16
156 0.16
157 0.15
158 0.14
159 0.14
160 0.12
161 0.13
162 0.14
163 0.13
164 0.14
165 0.12
166 0.11
167 0.09
168 0.09
169 0.09
170 0.09
171 0.1
172 0.09
173 0.09
174 0.16
175 0.17
176 0.18
177 0.19
178 0.19
179 0.24
180 0.24
181 0.26
182 0.21
183 0.23
184 0.23
185 0.25
186 0.26
187 0.24
188 0.33
189 0.35
190 0.35
191 0.39
192 0.46
193 0.53
194 0.59
195 0.66
196 0.66
197 0.71
198 0.73
199 0.67
200 0.63
201 0.55
202 0.46
203 0.38
204 0.3
205 0.23
206 0.2
207 0.2
208 0.16