Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RNM4

Protein Details
Accession A0A1L9RNM4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MLRYTKRKARPKRRPCLIHTKKKKAKRNASSVNRTRASHydrophilic
NLS Segment(s)
PositionSequence
6-28KRKARPKRRPCLIHTKKKKAKRN
Subcellular Location(s) nucl 14.5, mito_nucl 12.833, cyto_nucl 9.666, mito 9
Family & Domain DBs
Amino Acid Sequences MLRYTKRKARPKRRPCLIHTKKKKAKRNASSVNRTRASSMATMNSTTRPMMLFLLKSQSSFCFMWGKRREKKSAEFVCDGPRNHAIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.88
3 0.88
4 0.88
5 0.88
6 0.87
7 0.88
8 0.86
9 0.88
10 0.9
11 0.9
12 0.9
13 0.88
14 0.88
15 0.87
16 0.88
17 0.88
18 0.85
19 0.82
20 0.73
21 0.64
22 0.55
23 0.44
24 0.37
25 0.28
26 0.22
27 0.16
28 0.15
29 0.15
30 0.15
31 0.15
32 0.13
33 0.11
34 0.1
35 0.08
36 0.08
37 0.09
38 0.1
39 0.1
40 0.1
41 0.15
42 0.15
43 0.15
44 0.15
45 0.14
46 0.18
47 0.17
48 0.18
49 0.21
50 0.22
51 0.32
52 0.4
53 0.49
54 0.53
55 0.61
56 0.66
57 0.65
58 0.72
59 0.72
60 0.72
61 0.7
62 0.64
63 0.59
64 0.61
65 0.61
66 0.55
67 0.49