Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9R644

Protein Details
Accession A0A1L9R644    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MNMTSRRNRVRHQRALWRVHPYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 10, cyto 1, extr 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNMTSRRNRVRHQRALWRVHPYLAGGTMLFEYIYRWTFSRRMIRNTSFKIVSSTSKISLSLIIYVLLISITSRMQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.81
4 0.77
5 0.68
6 0.58
7 0.5
8 0.4
9 0.32
10 0.24
11 0.19
12 0.1
13 0.1
14 0.08
15 0.08
16 0.06
17 0.05
18 0.05
19 0.06
20 0.07
21 0.08
22 0.08
23 0.11
24 0.13
25 0.19
26 0.27
27 0.3
28 0.35
29 0.41
30 0.46
31 0.51
32 0.53
33 0.53
34 0.45
35 0.41
36 0.38
37 0.33
38 0.3
39 0.27
40 0.26
41 0.23
42 0.23
43 0.22
44 0.2
45 0.2
46 0.18
47 0.14
48 0.12
49 0.11
50 0.1
51 0.09
52 0.09
53 0.06
54 0.05
55 0.04
56 0.05