Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VCJ6

Protein Details
Accession G0VCJ6    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68TSSLKHSKGNVKGRFNPRYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, cyto 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ncs:NCAS_0C02160  -  
Amino Acid Sequences MSAVQRLFLQRALNTASHSPATRTRISNIYMVYLAAGLTLPFLLPAAETSSLKHSKGNVKGRFNPRYFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.21
5 0.21
6 0.21
7 0.24
8 0.27
9 0.29
10 0.29
11 0.29
12 0.31
13 0.32
14 0.32
15 0.27
16 0.23
17 0.19
18 0.17
19 0.14
20 0.1
21 0.08
22 0.05
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.02
29 0.03
30 0.03
31 0.03
32 0.04
33 0.06
34 0.08
35 0.09
36 0.1
37 0.17
38 0.2
39 0.2
40 0.22
41 0.25
42 0.32
43 0.41
44 0.5
45 0.52
46 0.59
47 0.68
48 0.76
49 0.8