Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9RTX5

Protein Details
Accession A0A1L9RTX5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-66CLTCGYCGNRRRTRTRRSRIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 6, vacu 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVVSCITSIFHAIGACLMGIVNTIGSICQAIISGVVTLLDVIIACLTCGYCGNRRRTRTRRSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.05
6 0.05
7 0.03
8 0.04
9 0.04
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.02
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.07
38 0.1
39 0.18
40 0.25
41 0.36
42 0.44
43 0.52
44 0.62
45 0.7
46 0.78