Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9R928

Protein Details
Accession A0A1L9R928    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-52NAIRRSTNACQRCKRRKIKCHYNSDNSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MPPLGIMESPDQRRMSNRTQSRHVNAIRRSTNACQRCKRRKIKCHYNSDNSHHKCVACSRSYSGNHQLLWFETYRLLTLKNVYLMPLLMAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.47
4 0.52
5 0.52
6 0.58
7 0.65
8 0.65
9 0.67
10 0.64
11 0.62
12 0.59
13 0.62
14 0.57
15 0.52
16 0.51
17 0.47
18 0.51
19 0.5
20 0.53
21 0.53
22 0.61
23 0.69
24 0.75
25 0.81
26 0.82
27 0.84
28 0.87
29 0.89
30 0.88
31 0.88
32 0.86
33 0.84
34 0.79
35 0.75
36 0.75
37 0.67
38 0.61
39 0.52
40 0.44
41 0.37
42 0.37
43 0.36
44 0.28
45 0.27
46 0.27
47 0.33
48 0.35
49 0.39
50 0.42
51 0.4
52 0.38
53 0.36
54 0.35
55 0.28
56 0.29
57 0.24
58 0.16
59 0.14
60 0.14
61 0.14
62 0.14
63 0.14
64 0.14
65 0.17
66 0.19
67 0.2
68 0.2
69 0.19
70 0.19
71 0.18