Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VG22

Protein Details
Accession G0VG22   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-120FEASRTTEKQQKKQRAFPQRKYAIKAHydrophilic
NLS Segment(s)
PositionSequence
72-115GKKYQPKDLRAKKTRALRRALTKFEASRTTEKQQKKQRAFPQRK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG ncs:NCAS_0E03710  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAGVKAYELRTKSKEQLESQLIDLKKELAELKVQKLSKPSLPKINTVRKDIARVLTVINQQQRDAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASRTTEKQQKKQRAFPQRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.55
4 0.54
5 0.51
6 0.48
7 0.47
8 0.4
9 0.34
10 0.31
11 0.23
12 0.18
13 0.18
14 0.17
15 0.12
16 0.19
17 0.21
18 0.25
19 0.3
20 0.31
21 0.3
22 0.33
23 0.35
24 0.34
25 0.39
26 0.39
27 0.42
28 0.43
29 0.49
30 0.54
31 0.6
32 0.58
33 0.55
34 0.56
35 0.48
36 0.49
37 0.44
38 0.38
39 0.28
40 0.25
41 0.21
42 0.2
43 0.21
44 0.21
45 0.22
46 0.2
47 0.19
48 0.21
49 0.21
50 0.2
51 0.19
52 0.19
53 0.17
54 0.21
55 0.29
56 0.34
57 0.38
58 0.4
59 0.47
60 0.52
61 0.54
62 0.61
63 0.62
64 0.65
65 0.71
66 0.77
67 0.79
68 0.78
69 0.8
70 0.76
71 0.77
72 0.76
73 0.72
74 0.69
75 0.65
76 0.68
77 0.7
78 0.69
79 0.63
80 0.6
81 0.55
82 0.52
83 0.5
84 0.45
85 0.44
86 0.44
87 0.48
88 0.5
89 0.56
90 0.62
91 0.67
92 0.73
93 0.75
94 0.79
95 0.82
96 0.85
97 0.88
98 0.88
99 0.89
100 0.88