Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RV84

Protein Details
Accession A0A1L9RV84   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
102-121PNPYEKPKPKFSPRLLWSRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto 6, mito 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR012171  Fatty_acid_desaturase  
Gene Ontology GO:0016491  F:oxidoreductase activity  
GO:0006665  P:sphingolipid metabolic process  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MEDNSSKLGSMQHETAQATDHLPHIPASQVQAADGKNGSRLWIVIDDIVYDVTEFCRRHPGGEMPLRHFAGQSCSWQFRQIHGPQTLERYRELQVGRTDGVPNPYEKPKPKFSPRLLWSRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.21
5 0.18
6 0.17
7 0.16
8 0.13
9 0.13
10 0.14
11 0.13
12 0.13
13 0.12
14 0.14
15 0.15
16 0.14
17 0.14
18 0.17
19 0.16
20 0.16
21 0.16
22 0.14
23 0.14
24 0.14
25 0.14
26 0.11
27 0.11
28 0.1
29 0.11
30 0.11
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.06
37 0.05
38 0.04
39 0.05
40 0.1
41 0.1
42 0.11
43 0.19
44 0.19
45 0.2
46 0.23
47 0.25
48 0.27
49 0.33
50 0.35
51 0.31
52 0.35
53 0.34
54 0.31
55 0.29
56 0.22
57 0.21
58 0.2
59 0.2
60 0.19
61 0.21
62 0.22
63 0.27
64 0.27
65 0.25
66 0.32
67 0.32
68 0.36
69 0.36
70 0.38
71 0.34
72 0.41
73 0.42
74 0.35
75 0.32
76 0.28
77 0.26
78 0.29
79 0.29
80 0.27
81 0.27
82 0.28
83 0.28
84 0.27
85 0.27
86 0.24
87 0.27
88 0.23
89 0.22
90 0.24
91 0.3
92 0.36
93 0.42
94 0.47
95 0.53
96 0.61
97 0.69
98 0.75
99 0.75
100 0.78
101 0.77
102 0.81