Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VD03

Protein Details
Accession G0VD03    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-94YLKYLTKKYLKKNQLRDWIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto_nucl 10, cyto 9, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0C03740  -  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPNTSRKQKIVKTFTVDVSSPTENGVFDPSSYAKYLIDHIKVEGSVGNLGNAITVSEDGSIVTIVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFISTKTNSYKLSFYQVTPEEGEDEEEEVDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.62
3 0.58
4 0.5
5 0.42
6 0.38
7 0.32
8 0.25
9 0.22
10 0.19
11 0.15
12 0.15
13 0.16
14 0.11
15 0.1
16 0.13
17 0.13
18 0.14
19 0.15
20 0.15
21 0.12
22 0.12
23 0.17
24 0.18
25 0.2
26 0.18
27 0.18
28 0.18
29 0.18
30 0.17
31 0.14
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.08
38 0.07
39 0.06
40 0.05
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.05
55 0.05
56 0.07
57 0.08
58 0.09
59 0.15
60 0.16
61 0.21
62 0.25
63 0.34
64 0.36
65 0.4
66 0.47
67 0.5
68 0.56
69 0.6
70 0.65
71 0.67
72 0.71
73 0.77
74 0.79
75 0.8
76 0.79
77 0.74
78 0.71
79 0.65
80 0.58
81 0.5
82 0.43
83 0.42
84 0.4
85 0.42
86 0.4
87 0.41
88 0.41
89 0.42
90 0.43
91 0.35
92 0.39
93 0.35
94 0.31
95 0.33
96 0.32
97 0.33
98 0.31
99 0.3
100 0.24
101 0.22
102 0.24
103 0.17
104 0.17
105 0.14