Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9R653

Protein Details
Accession A0A1L9R653    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-100RCLSCCCPSGRRRGNKSKYLDEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 4, plas 4, cyto 2, extr 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR037504  PSI_induc_2  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSPVLDKTPNPLWARDAISDLKSAPQTFSSWDSCMAKSYCKWPVIVAIIVGAVIVIAILACVINCLCCGIQCCTGCCRCLSCCCPSGRRRGNKSKYLDEQSPYNNQPYNQPPAPSNNIYQPSPAPPVYRGAQVSRYDSPSTARFDAPSSPAASKVNDDALPAMPSWDDAVTRRVEDKNAHVDEMEMEPLNPSQEPHRMHSGARSNTPAFMGVPPVRTGTSSSYYPESRYDAPSTYGAHTPAPASPGHSPYDNQPYADYNQPPPFHAMSPAMSPAPAAYSPYDPMPSASPAADMSRPVPYCQPSPGSGMPFRQPSPGPNMPLRQPSPGPNFPFRQPSPGPGVPFRQASPGPNAPFRQPSPAGYAQSPIYRGVSPSLPPSSPPPPFTATPSSLDMHVNEPAGRPPSLLQSGRKPATNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.36
4 0.32
5 0.31
6 0.31
7 0.28
8 0.28
9 0.28
10 0.27
11 0.25
12 0.23
13 0.23
14 0.24
15 0.29
16 0.27
17 0.25
18 0.29
19 0.31
20 0.29
21 0.34
22 0.32
23 0.32
24 0.32
25 0.38
26 0.4
27 0.38
28 0.38
29 0.33
30 0.37
31 0.36
32 0.34
33 0.26
34 0.19
35 0.17
36 0.16
37 0.15
38 0.08
39 0.04
40 0.03
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.04
50 0.04
51 0.04
52 0.06
53 0.06
54 0.08
55 0.12
56 0.15
57 0.22
58 0.23
59 0.26
60 0.31
61 0.33
62 0.33
63 0.32
64 0.31
65 0.28
66 0.35
67 0.37
68 0.36
69 0.4
70 0.44
71 0.51
72 0.53
73 0.61
74 0.63
75 0.69
76 0.73
77 0.78
78 0.82
79 0.82
80 0.83
81 0.8
82 0.79
83 0.75
84 0.7
85 0.61
86 0.57
87 0.52
88 0.53
89 0.47
90 0.43
91 0.39
92 0.34
93 0.39
94 0.38
95 0.42
96 0.37
97 0.37
98 0.34
99 0.38
100 0.44
101 0.4
102 0.37
103 0.36
104 0.37
105 0.36
106 0.35
107 0.31
108 0.28
109 0.3
110 0.29
111 0.23
112 0.21
113 0.25
114 0.25
115 0.27
116 0.25
117 0.23
118 0.28
119 0.28
120 0.32
121 0.31
122 0.33
123 0.3
124 0.28
125 0.29
126 0.26
127 0.29
128 0.26
129 0.24
130 0.21
131 0.21
132 0.24
133 0.23
134 0.21
135 0.19
136 0.17
137 0.18
138 0.19
139 0.18
140 0.16
141 0.15
142 0.16
143 0.14
144 0.14
145 0.13
146 0.13
147 0.13
148 0.12
149 0.11
150 0.07
151 0.07
152 0.08
153 0.07
154 0.07
155 0.07
156 0.1
157 0.11
158 0.12
159 0.15
160 0.15
161 0.17
162 0.18
163 0.22
164 0.27
165 0.27
166 0.27
167 0.23
168 0.23
169 0.21
170 0.2
171 0.17
172 0.08
173 0.07
174 0.08
175 0.08
176 0.08
177 0.07
178 0.06
179 0.08
180 0.14
181 0.17
182 0.19
183 0.24
184 0.25
185 0.25
186 0.31
187 0.36
188 0.32
189 0.32
190 0.32
191 0.28
192 0.27
193 0.27
194 0.21
195 0.14
196 0.12
197 0.14
198 0.12
199 0.12
200 0.12
201 0.13
202 0.13
203 0.12
204 0.14
205 0.13
206 0.15
207 0.14
208 0.15
209 0.18
210 0.18
211 0.19
212 0.19
213 0.19
214 0.18
215 0.2
216 0.21
217 0.18
218 0.2
219 0.2
220 0.2
221 0.19
222 0.18
223 0.17
224 0.15
225 0.14
226 0.13
227 0.12
228 0.12
229 0.1
230 0.12
231 0.13
232 0.15
233 0.16
234 0.16
235 0.16
236 0.19
237 0.28
238 0.26
239 0.24
240 0.22
241 0.24
242 0.25
243 0.3
244 0.28
245 0.24
246 0.29
247 0.3
248 0.3
249 0.31
250 0.3
251 0.25
252 0.25
253 0.22
254 0.17
255 0.18
256 0.18
257 0.14
258 0.12
259 0.12
260 0.09
261 0.1
262 0.09
263 0.09
264 0.09
265 0.1
266 0.12
267 0.13
268 0.14
269 0.12
270 0.13
271 0.13
272 0.14
273 0.13
274 0.12
275 0.12
276 0.12
277 0.14
278 0.13
279 0.12
280 0.12
281 0.17
282 0.18
283 0.19
284 0.22
285 0.23
286 0.24
287 0.27
288 0.28
289 0.24
290 0.29
291 0.3
292 0.3
293 0.3
294 0.31
295 0.32
296 0.34
297 0.33
298 0.31
299 0.3
300 0.28
301 0.34
302 0.36
303 0.36
304 0.37
305 0.4
306 0.41
307 0.48
308 0.47
309 0.43
310 0.4
311 0.44
312 0.47
313 0.51
314 0.52
315 0.5
316 0.52
317 0.51
318 0.57
319 0.5
320 0.5
321 0.44
322 0.43
323 0.45
324 0.45
325 0.45
326 0.41
327 0.44
328 0.4
329 0.41
330 0.37
331 0.34
332 0.33
333 0.32
334 0.35
335 0.38
336 0.38
337 0.42
338 0.43
339 0.42
340 0.46
341 0.45
342 0.45
343 0.4
344 0.38
345 0.4
346 0.43
347 0.42
348 0.37
349 0.38
350 0.32
351 0.33
352 0.32
353 0.26
354 0.23
355 0.21
356 0.21
357 0.22
358 0.22
359 0.21
360 0.25
361 0.28
362 0.26
363 0.27
364 0.32
365 0.37
366 0.38
367 0.39
368 0.38
369 0.39
370 0.4
371 0.44
372 0.46
373 0.4
374 0.39
375 0.4
376 0.37
377 0.34
378 0.34
379 0.3
380 0.25
381 0.25
382 0.23
383 0.2
384 0.2
385 0.24
386 0.25
387 0.24
388 0.22
389 0.21
390 0.27
391 0.34
392 0.38
393 0.38
394 0.44
395 0.54
396 0.56