Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RIM3

Protein Details
Accession A0A1L9RIM3   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MYKNGRWTRKEDSKRREEKRRPIRGKTPDLLBasic
NLS Segment(s)
PositionSequence
8-85TRKEDSKRREEKRRPIRGKTPDLLMRQKMGRSPGMGMGEMKIGGRRGGKGGVEKEENREEEREKRVGESERKRWRGGR
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MYKNGRWTRKEDSKRREEKRRPIRGKTPDLLMRQKMGRSPGMGMGEMKIGGRRGGKGGVEKEENREEEREKRVGESERKRWRGGRGVEGEEEEEELGRLLGGEDGQESDERVTRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.9
4 0.89
5 0.9
6 0.9
7 0.91
8 0.89
9 0.87
10 0.88
11 0.86
12 0.84
13 0.76
14 0.72
15 0.68
16 0.66
17 0.63
18 0.55
19 0.49
20 0.43
21 0.42
22 0.37
23 0.34
24 0.29
25 0.24
26 0.23
27 0.23
28 0.22
29 0.21
30 0.18
31 0.15
32 0.14
33 0.12
34 0.11
35 0.08
36 0.07
37 0.08
38 0.09
39 0.09
40 0.1
41 0.12
42 0.13
43 0.15
44 0.17
45 0.18
46 0.21
47 0.2
48 0.23
49 0.25
50 0.26
51 0.24
52 0.24
53 0.24
54 0.26
55 0.3
56 0.29
57 0.26
58 0.26
59 0.29
60 0.33
61 0.4
62 0.43
63 0.49
64 0.56
65 0.6
66 0.61
67 0.61
68 0.61
69 0.6
70 0.56
71 0.55
72 0.51
73 0.5
74 0.48
75 0.45
76 0.4
77 0.31
78 0.27
79 0.18
80 0.12
81 0.09
82 0.07
83 0.06
84 0.05
85 0.05
86 0.04
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.08
93 0.08
94 0.09
95 0.1