Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9RG16

Protein Details
Accession A0A1L9RG16    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-98VSDWKTRRSTFRRRERPAYGAFLEKPRRERKRARARGYRDEVRRPABasic
NLS Segment(s)
PositionSequence
60-96RSTFRRRERPAYGAFLEKPRRERKRARARGYRDEVRR
Subcellular Location(s) extr 14, plas 5, cyto 4, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPALLPRQTSPDCPSSITGGGIAGIVVGTIAGTLLILWLLRLCADPQVRSGDVSDWKTRRSTFRRRERPAYGAFLEKPRRERKRARARGYRDEVRRPAKVYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.29
4 0.25
5 0.2
6 0.15
7 0.14
8 0.11
9 0.09
10 0.05
11 0.04
12 0.03
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.09
31 0.11
32 0.12
33 0.13
34 0.16
35 0.16
36 0.16
37 0.17
38 0.14
39 0.16
40 0.19
41 0.23
42 0.21
43 0.23
44 0.25
45 0.26
46 0.33
47 0.37
48 0.45
49 0.5
50 0.6
51 0.69
52 0.75
53 0.8
54 0.77
55 0.75
56 0.68
57 0.63
58 0.54
59 0.48
60 0.42
61 0.43
62 0.45
63 0.43
64 0.46
65 0.51
66 0.57
67 0.62
68 0.7
69 0.73
70 0.77
71 0.84
72 0.86
73 0.86
74 0.87
75 0.89
76 0.88
77 0.86
78 0.82
79 0.81
80 0.8
81 0.76
82 0.72
83 0.65