Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9R4X7

Protein Details
Accession A0A1L9R4X7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-103ASVTEPPRRKRGRPRKGEVVTKDBasic
NLS Segment(s)
PositionSequence
87-97PRRKRGRPRKG
Subcellular Location(s) nucl 22.5, cyto_nucl 14.333, mito_nucl 12.166
Family & Domain DBs
Amino Acid Sequences MSSPLTPLGSSPSDLDPTPELTSLLSASSYPLPVQLMPQPESDQQSHLYGGYGGEQLPTSDPPGSPIQEVSPSHLQSNESASVTEPPRRKRGRPRKGEVVTKDDRPDEVRVESLISHPVVPVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.19
4 0.21
5 0.21
6 0.19
7 0.17
8 0.14
9 0.15
10 0.13
11 0.11
12 0.08
13 0.07
14 0.08
15 0.09
16 0.09
17 0.09
18 0.09
19 0.1
20 0.1
21 0.12
22 0.13
23 0.17
24 0.18
25 0.19
26 0.21
27 0.22
28 0.26
29 0.24
30 0.22
31 0.2
32 0.19
33 0.18
34 0.16
35 0.13
36 0.1
37 0.09
38 0.09
39 0.08
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.1
50 0.12
51 0.13
52 0.12
53 0.12
54 0.11
55 0.15
56 0.16
57 0.18
58 0.2
59 0.2
60 0.21
61 0.21
62 0.21
63 0.18
64 0.21
65 0.18
66 0.14
67 0.13
68 0.13
69 0.17
70 0.19
71 0.24
72 0.27
73 0.3
74 0.4
75 0.45
76 0.53
77 0.59
78 0.69
79 0.73
80 0.78
81 0.82
82 0.83
83 0.85
84 0.86
85 0.8
86 0.77
87 0.71
88 0.66
89 0.61
90 0.51
91 0.45
92 0.39
93 0.37
94 0.32
95 0.3
96 0.26
97 0.23
98 0.23
99 0.21
100 0.19
101 0.2
102 0.17
103 0.15