Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RRH2

Protein Details
Accession A0A1L9RRH2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-114NEPATPKKKKEPAAKKQKAAAPKRATKRKKVSEPEDDDEBasic
NLS Segment(s)
PositionSequence
80-105TPKKKKEPAAKKQKAAAPKRATKRKK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAPKAPPDASLMFLWTCLQNSDFTTVNYAAVGAATNTNVPAVRMRFTRLKKWIENGQNSEGNAEDGESEPATPKENEPATPKKKKEPAAKKQKAAAPKRATKRKKVSEPEDDDEDVDEEVENAEAVVKPEDADEKKTAIKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.14
4 0.13
5 0.13
6 0.12
7 0.14
8 0.17
9 0.16
10 0.16
11 0.19
12 0.18
13 0.17
14 0.15
15 0.14
16 0.1
17 0.09
18 0.09
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.11
28 0.12
29 0.14
30 0.15
31 0.19
32 0.27
33 0.31
34 0.39
35 0.42
36 0.47
37 0.47
38 0.52
39 0.56
40 0.56
41 0.59
42 0.55
43 0.52
44 0.47
45 0.44
46 0.39
47 0.31
48 0.23
49 0.16
50 0.11
51 0.07
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.09
59 0.09
60 0.08
61 0.13
62 0.14
63 0.16
64 0.21
65 0.3
66 0.37
67 0.45
68 0.47
69 0.5
70 0.56
71 0.63
72 0.68
73 0.69
74 0.72
75 0.75
76 0.8
77 0.76
78 0.75
79 0.71
80 0.7
81 0.66
82 0.65
83 0.62
84 0.63
85 0.69
86 0.74
87 0.76
88 0.77
89 0.81
90 0.81
91 0.83
92 0.84
93 0.82
94 0.82
95 0.83
96 0.78
97 0.72
98 0.62
99 0.52
100 0.43
101 0.36
102 0.25
103 0.17
104 0.12
105 0.07
106 0.07
107 0.06
108 0.05
109 0.04
110 0.05
111 0.06
112 0.07
113 0.09
114 0.09
115 0.09
116 0.1
117 0.18
118 0.19
119 0.24
120 0.24
121 0.26