Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9REV4

Protein Details
Accession A0A1L9REV4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
105-128NTHNASKRTSCEKKRRKLGSKLDKHydrophilic
NLS Segment(s)
PositionSequence
117-127KKRRKLGSKLD
Subcellular Location(s) plas 10, E.R. 5, mito 4, extr 4, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MSQSIVRFPLSVFFFSCLSLLICLFTIIPLSFCFHLSPPTVEHIPSGIQSRSHATPCLSLITSHFVELPAAPYATLPVLSSQLDIYNARPSPAFPSPGKQSREGNTHNASKRTSCEKKRRKLGSKLDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.14
5 0.12
6 0.12
7 0.1
8 0.09
9 0.08
10 0.08
11 0.08
12 0.07
13 0.08
14 0.07
15 0.08
16 0.08
17 0.1
18 0.11
19 0.12
20 0.13
21 0.12
22 0.15
23 0.16
24 0.17
25 0.16
26 0.2
27 0.19
28 0.18
29 0.18
30 0.16
31 0.14
32 0.14
33 0.16
34 0.12
35 0.12
36 0.13
37 0.16
38 0.18
39 0.18
40 0.18
41 0.16
42 0.16
43 0.16
44 0.17
45 0.14
46 0.12
47 0.12
48 0.14
49 0.14
50 0.13
51 0.12
52 0.1
53 0.1
54 0.1
55 0.1
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.06
66 0.07
67 0.07
68 0.07
69 0.08
70 0.09
71 0.1
72 0.1
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.2
79 0.22
80 0.26
81 0.21
82 0.26
83 0.34
84 0.42
85 0.45
86 0.43
87 0.45
88 0.46
89 0.53
90 0.51
91 0.5
92 0.48
93 0.54
94 0.55
95 0.54
96 0.51
97 0.45
98 0.47
99 0.5
100 0.54
101 0.56
102 0.62
103 0.69
104 0.77
105 0.85
106 0.9
107 0.9
108 0.9